KEGG   Fervidobacterium nodosum: Fnod_0046Help
Entry
Fnod_0046         CDS       T00579                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
fno  Fervidobacterium nodosum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:fno02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:fno02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
48483..49520
Genome map
AA seq 345 aa AA seqDB search
MENTKIKVMIVDDSPFMRMILKDLLDQQPDIQVVAVAKDGMEAVELALKYKPDVITMDVE
MPKLNGIEALKEIMKRSPTRVIMVSSLTEEGAEITLLALELGAVDFVTKPSGSVSMDFRK
IGPELVEKIRSAMKIDLSHILLKKKPVAGLKLKSMVSSKIVVIGSSTGGPRSLDLVIPPL
PKEFPAPILIVQHMPPGFTKSLAQRLDRISNLSVKEAEEGDEIKPGWVYIAPGDYHMGIK
HQDRKSIIYLDKRTEKINNVRPSVDYTLDKVAEIYKEKTIAVILTGMGRDGAKGAFKVKF
FKGNVIAESQETCVVYGMPKAVVDEGYADFVLPADKIPEKLVEIV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaacacgaaaatcaaagttatgatagttgatgattcgccttttatgaggatgata
ttgaaggacttattagatcaacaacctgacatacaagttgttgcagttgcaaaggatgga
atggaggcagtagaattagccttaaaatataaacctgatgttattactatggatgttgaa
atgccaaaattaaatggtatagaggctttgaaagaaataatgaagaggtcacctacaaga
gtgataatggttagtagtcttacggaagaaggagcagaaataacacttttagctttggag
cttggtgcagttgattttgtaacaaagccctctggaagtgtttcaatggactttagaaaa
attggaccagaattggtggaaaaaattcgttctgcgatgaaaatagatttgtcacacata
ttacttaagaagaaaccagttgctggattaaagttgaaatccatggtttcaagtaagata
gtagtaattggctcatccacaggtggaccgcgttcgcttgatttggttattccgcctttg
ccaaaggaatttcctgcacctatactaattgttcagcatatgccacctggttttacaaag
tcgttagcgcaaagattggatagaatatctaatctttccgtgaaagaagctgaagaaggt
gacgagattaaacctggttgggtgtacatagcgcctggggattaccatatggggattaaa
catcaagatagaaaaagtataatctatcttgataaaagaaccgaaaagataaataatgtc
aggccttctgttgattatacacttgataaagtggctgaaatttacaaagagaaaacaatc
gccgttattcttaccggaatgggacgagatggggctaagggagcttttaaagtaaagttt
ttcaaaggaaatgttatagcggaaagtcaagaaacatgtgttgtgtacggtatgccaaaa
gccgtagttgatgaaggatatgccgactttgttcttccagctgataaaattccagaaaaa
cttgttgaaattgtatga

DBGET integrated database retrieval system