KEGG   Fervidobacterium nodosum: Fnod_0046Help
Entry
Fnod_0046         CDS       T00579                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
fno  Fervidobacterium nodosum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:fno00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fnod_0046
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Fnod_0046
Enzymes [BR:fno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Fnod_0046
Two-component system [BR:fno02022]
 CheA family
  CheA-CheYBV
   Fnod_0046
Bacterial motility proteins [BR:fno02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Fnod_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
48483..49520
Genome map
AA seq 345 aa AA seqDB search
MENTKIKVMIVDDSPFMRMILKDLLDQQPDIQVVAVAKDGMEAVELALKYKPDVITMDVE
MPKLNGIEALKEIMKRSPTRVIMVSSLTEEGAEITLLALELGAVDFVTKPSGSVSMDFRK
IGPELVEKIRSAMKIDLSHILLKKKPVAGLKLKSMVSSKIVVIGSSTGGPRSLDLVIPPL
PKEFPAPILIVQHMPPGFTKSLAQRLDRISNLSVKEAEEGDEIKPGWVYIAPGDYHMGIK
HQDRKSIIYLDKRTEKINNVRPSVDYTLDKVAEIYKEKTIAVILTGMGRDGAKGAFKVKF
FKGNVIAESQETCVVYGMPKAVVDEGYADFVLPADKIPEKLVEIV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaacacgaaaatcaaagttatgatagttgatgattcgccttttatgaggatgata
ttgaaggacttattagatcaacaacctgacatacaagttgttgcagttgcaaaggatgga
atggaggcagtagaattagccttaaaatataaacctgatgttattactatggatgttgaa
atgccaaaattaaatggtatagaggctttgaaagaaataatgaagaggtcacctacaaga
gtgataatggttagtagtcttacggaagaaggagcagaaataacacttttagctttggag
cttggtgcagttgattttgtaacaaagccctctggaagtgtttcaatggactttagaaaa
attggaccagaattggtggaaaaaattcgttctgcgatgaaaatagatttgtcacacata
ttacttaagaagaaaccagttgctggattaaagttgaaatccatggtttcaagtaagata
gtagtaattggctcatccacaggtggaccgcgttcgcttgatttggttattccgcctttg
ccaaaggaatttcctgcacctatactaattgttcagcatatgccacctggttttacaaag
tcgttagcgcaaagattggatagaatatctaatctttccgtgaaagaagctgaagaaggt
gacgagattaaacctggttgggtgtacatagcgcctggggattaccatatggggattaaa
catcaagatagaaaaagtataatctatcttgataaaagaaccgaaaagataaataatgtc
aggccttctgttgattatacacttgataaagtggctgaaatttacaaagagaaaacaatc
gccgttattcttaccggaatgggacgagatggggctaagggagcttttaaagtaaagttt
ttcaaaggaaatgttatagcggaaagtcaagaaacatgtgttgtgtacggtatgccaaaa
gccgtagttgatgaaggatatgccgactttgttcttccagctgataaaattccagaaaaa
cttgttgaaattgtatga

DBGET integrated database retrieval system