KEGG   Fervidobacterium nodosum: Fnod_0088Help
Entry
Fnod_0088         CDS       T00579                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00010  Glycolysis / Gluconeogenesis
fno00052  Galactose metabolism
fno00500  Starch and sucrose metabolism
fno00520  Amino sugar and nucleotide sugar metabolism
fno00521  Streptomycin biosynthesis
fno01100  Metabolic pathways
fno01110  Biosynthesis of secondary metabolites
fno01120  Microbial metabolism in diverse environments
fno01130  Biosynthesis of antibiotics
fno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fnod_0088
   00052 Galactose metabolism
    Fnod_0088
   00500 Starch and sucrose metabolism
    Fnod_0088
   00520 Amino sugar and nucleotide sugar metabolism
    Fnod_0088
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fnod_0088
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Fnod_0088
Enzymes [BR:fno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Fnod_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG DUF4445 FGGY_N MutL
Motif
Other DBs
NCBI-ProteinID: ABS59955
JGI: Fnod0088
UniProt: A7HJ72
Position
95422..96363
Genome map
AA seq 313 aa AA seqDB search
MYVVGIDLGGTFFKVGLVDAESGKILRKLERETKVNEGGDSVIQRMAEAVEEITEGIEYI
GVGIGSPGSIDHDKGIVRFSPNFPGWVNFELGGLLSNKLNKPVFVENDANAFVLGEKWFG
AGKGYNHIVALTLGTGVGGGVISHGMLITGHNGIGTELGHVIIEPNGPQCGCGNYGCLEA
LASATAIRRMALEGQKKFPESVIFQSENVDAKSVFEAAKMGDGLGKAIVDRVVNALSIGI
ANFIHIFNPEIIVVGGGVSRAGDILFEPIREKVQHLVMPSFKGTYKIVQSPLVEEAGILG
AASVILQNVNKPK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtagtaggtatagatcttggtggtacatttttcaaagtaggtcttgttgatgct
gagagtggtaagatattaagaaaattggaacgtgaaacaaaggttaacgaaggtggagat
agtgttatccaaaggatggcggaagcggtagaagaaattaccgaaggcattgaatatatt
ggggttggtattggttcaccaggttcaatagatcacgataaagggatagtaaggttttcg
ccgaatttcccagggtgggtaaattttgaacttgggggtttactttcaaataaattaaat
aaacctgtattcgttgaaaacgatgctaatgcatttgtgcttggtgaaaaatggtttggt
gcgggcaaaggttataatcatatagttgcgcttacacttggtacaggtgtcggtggtggt
gtcatatcccatggaatgcttataacaggtcacaacggtataggtacagaattagggcat
gttataatagaaccaaatggtccacaatgtggatgtggtaattacggatgtctcgaagca
ctcgcaagtgcaaccgctatcagaaggatggctttagaaggacagaaaaaatttccagaa
tctgttatttttcaatcagaaaatgtcgacgccaaatctgtttttgaagcagcgaagatg
ggagatggcttgggaaaagctatagtcgatagagttgtgaacgcactttcaattggcatt
gccaattttatacatatattcaaccctgaaatcattgttgttggtggaggagtttccagg
gcgggagatattttatttgagcctataagggaaaaagtgcaacatttagttatgccatct
tttaagggaacttacaaaattgttcaaagtccattggtagaagaagccggcattcttggt
gcagcatcggttattttgcagaatgtaaataaaccaaaataa

DBGET integrated database retrieval system