KEGG   Fervidobacterium nodosum: Fnod_0223Help
Entry
Fnod_0223         CDS       T00579                                 

Gene name
pyrB
Definition
bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
fno  Fervidobacterium nodosum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Fnod_0223 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Fnod_0223 (pyrB)
Enzymes [BR:fno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Fnod_0223 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
228866..230440
Genome map
AA seq 524 aa AA seqDB search
MKRDFLGRTLAVINDFSVEEQLFLYKSTQKLKEKIRNKEDVSEFQIKRETGIYIVFVEPS
TRTKESFINAAKFHKNAKVNVFDSEHSSFNKQESYVDTFNMLTGYSGYSIFILRTRLEGV
TRLLEQKVGEFAERHGIERPAFINGGDGKHEHPTQELLDEFTFLEQMNFDNSHIRIALVG
DLLHGRTVHSKANGLKVFKNVEVDLIAPEELQMPKSYIEKMKRNGFEVRLYSSIDEYLET
TNPAPIWYFTRLQLERMGEDILEKAHLLKKAVTFRKDMLDKIPEGTKFYHPLPRPKIDPE
IPTFLDTLPLNGWEHQAINGYWVRVVLLSMLGGALLADFDTTKKREELPDDFIIPAPIVD
GTKGVAKEGKRGIKPISNGTVIDHIAKGKTTEEIYNTIVKIRKILKIYDVDSADGIFKSA
DGNYKGYISLPDKYLSFKEIKKLAAISPNTTVNIIKDSRVVEKYRLQLPPRIYNFDEIRC
KNENCITNPAHGENVSASFIQVDGKFVCEYCETPHEYHEIWNVK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagactttttgggaaggacacttgcggttataaacgacttttctgttgaggaa
caacttttcttgtataagagtacgcagaagttaaaagaaaagattagaaacaaagaagat
gtttcagaatttcaaatcaaacgagagacaggtatatacatcgtctttgtagaaccttcc
acacgtacaaaggaatcgtttataaacgccgctaaattccacaaaaacgcaaaagtaaat
gtatttgattcagaacactcatcttttaataagcaagaaagctatgtagatacctttaac
atgttaacgggttacagtggatattcaattttcatactcagaacaagattagaaggtgtt
acacgcttactcgagcaaaaagttggtgaattcgcagagagacacggaatcgaacgccca
gcgtttattaatggtggagatggtaaacacgaacatccaacacaagaattactagacgaa
ttcacttttttagaacagatgaacttcgataattcccatattcgaatcgcacttgtcggt
gatttgttacatggaagaactgttcattcaaaagccaatgggttgaaagtctttaaaaat
gttgaagtcgatttaatagcaccggaagaactgcaaatgccgaaaagttatattgaaaaa
atgaagagaaatgggttcgaagttagattgtatagctcgatagatgagtatttagaaacc
accaatcccgcaccaatttggtacttcacaagattacaacttgaacgaatgggagaagat
atcctcgaaaaagcccaccttttgaaaaaagcagtcacattcagaaaagacatgctcgat
aaaataccagaaggtacaaagttttaccatccacttccaaggcccaagattgatcctgaa
attccgacattcttagacacgcttccactaaatggttgggaacatcaggcgattaatgga
tattgggtgagagttgttttgctttccatgcttggtggtgcacttttagcggattttgac
acaacaaagaaacgagaagaattacctgacgattttataatcccagctccaatagttgat
ggtacaaaaggtgttgctaaagaaggcaagcgaggaattaaacccatcagtaatggtacg
gttattgaccatatagcgaaaggtaaaacaactgaagagatttacaatactattgtaaag
ataagaaaaattctcaaaatttacgatgtggatagcgctgatggaatattcaaatctgct
gatggaaattacaaagggtacataagccttcctgataaatacctctcgttcaaagaaata
aagaaattagctgccatttcgccgaatacgacagtgaatataattaaagatagcagagtt
gtagaaaagtacagactgcagcttccaccgaggatttataatttcgatgaaattaggtgc
aaaaacgaaaactgtatcacaaacccagcgcatggagagaatgtttcggcatcgtttatt
caagttgatggtaaatttgtatgtgaatactgtgagactcctcacgagtaccacgaaatt
tggaatgtaaagtga

DBGET integrated database retrieval system