KEGG   Fervidobacterium nodosum: Fnod_0296Help
Entry
Fnod_0296         CDS       T00579                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fno  Fervidobacterium nodosum
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Fnod_0296
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Fnod_0296
Enzymes [BR:fno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Fnod_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(319475..320929)
Genome map
AA seq 484 aa AA seqDB search
MKTEKSLKIIILLSLLFILVNLSSNVTQKTNQKEMAKTMNNVKLWLTTVDQKFMLSEVDI
NNPVVSDFRETLRIAVDSNKKYQQMDGFGASLTDASAWLIFHKLSEEKRIEVMKKLFGRN
EGIGISFLRQPMGATDYTTKLYSYDDLPEGVKEDPELKYFSIKHDKQYIIPLLKLAMKIN
PELKIMASPWSAPGWMKTTGSMIGGSLLRQYYSVYAQYFVKFTKAYEKEGIPIYAITPQN
EPLYVPKEYPGMKMTWEEQADFIGEYLGPAFEKEGIKTKILTYDHNWDNTIYASYVLSHP
KASKYVAGSAWHFYGGKHEAMSQIKEMFPDKDIWFTEGSGGDWVPAFFNAFMDQMMHVIR
IPRNWSKTVVWWNIALDEKRGPTILSNSTCRGLIEINQETGEVKYNLDYYTLGHISKFVL
PGAYRIDSYTYSNLETVAFENPNGTKVLIVSNRTNTNKKIIVEEGGREFEYIIPGYAAVT
FVWD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaccgaaaaaagtttaaaaataataattctactatcgcttttgtttatcttagta
aacttatcatctaatgttacacaaaaaacaaatcaaaaggagatggcaaagacaatgaat
aatgtcaagctatggcttactactgttgaccaaaaattcatgttatccgaagtcgatatt
aataatcctgttgtttcagatttccgtgaaacactaaggattgcagttgattcgaataaa
aaataccagcaaatggatggattcggagcatctctcaccgatgcatcagcatggctaatt
ttccataaattatcagaggaaaaacgtatagaggtaatgaaaaaattgttcggcagaaat
gaagggataggaatttcgtttcttaggcagccaatgggtgcaactgattacacaactaag
ctatacagctatgatgatttgccagaaggtgtaaaagaagacccagaacttaaatatttc
tctatcaaacacgataagcagtacataatacctcttttgaaacttgctatgaaaataaat
ccagagttgaaaataatggcttctccttggagtgcacctggttggatgaagacaacggga
agcatgattggtggatctctcctaagacaatattatagcgtctatgcgcaatattttgta
aagttcacaaaagcatacgaaaaagaagggattccaatttacgcaatcacaccgcaaaat
gaacctttatatgttccaaaagaatatccaggaatgaaaatgacatgggaagagcaagcg
gatttcataggtgaataccttggacctgcgtttgaaaaagaagggataaagacgaagata
ctgacttacgaccacaattgggataataccatatacgcatcgtatgttttgtctcaccca
aaagcttcaaaatacgttgcaggctcagcgtggcatttttatggcgggaaacacgaagcg
atgagccaaataaaggaaatgttccctgataaagatatatggtttacagaaggttcaggt
ggtgattgggtacctgctttctttaatgcatttatggatcagatgatgcatgttatcaga
atcccaagaaattggtctaaaaccgttgtatggtggaatatagcattagatgagaagaga
ggaccaacgatattatcaaatagcacttgcagaggacttatagagattaatcaagaaacg
ggagaggtaaagtataatttggattattatacgttaggccatataagtaaatttgttctt
ccaggcgcttatcgaatagattcatacacatatagtaatttagaaacagtggcttttgaa
aatccaaatggaacaaaagttctcatagtctcgaaccgaacgaatacaaacaaaaaaatc
atagtcgaggagggagggagagaattcgaatatataattccggggtacgctgcggtaact
tttgtgtgggattga

DBGET integrated database retrieval system