KEGG   Fervidobacterium nodosum: Fnod_0417Help
Entry
Fnod_0417         CDS       T00579                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fno  Fervidobacterium nodosum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Fnod_0417
  Lipid metabolism
   00561 Glycerolipid metabolism
    Fnod_0417
   00600 Sphingolipid metabolism
    Fnod_0417
Enzymes [BR:fno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Fnod_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(453381..455069)
Genome map
AA seq 562 aa AA seqDB search
MNIYISSLKDLRKVTGYRKYENFECIVELEKIHLGYKVNVEVNGIVDEVEIFTFPKPERI
FLNNWQSWGPARVVSEDFSIDFPKELIQKFGFSASIMPEKYFNSLVSDYFIASDNFVIGA
LQSKVGHPFFELAKDSISVKLRFFGKSFDGWTKVESFVVLYENPDIALPYYADLVAKENN
ANYKRYNPIGWSSWYQYFLDFDYNKMISDLEKSYGYGYEVFQIDDAWERDIGDWEVNERF
PSLEEVASKIKEYGYTPGVWLAPFSVAETSDLFKNHPEWIVKDNNGNPIVAYENWNKKIY
ALDTTHPEAQKWLLNLFIDLKSKGFDYFKIDFLFAGAIQGKRYLNVTPVEAYRIGMETIR
KATGDSFVLGCGAPLLPSIGYVDGMRISADTAPYWDLNGPDIGYPNAYFALRNVITRSFM
NNVWWWNDPDCLMLRKEETQLSDNHRQLYTYVSLLLDNMIIQSDNLSLNIDKELWNVILE
YKKYGRRKYRVEGLMEGVYKITSCGLNGCDKLTIEDLGNAKYKIEFDIPRVKLFKSVEKR
EDGRTFNYYTEDNTGKAKGDVK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttatatttcatctctcaaagatttgcgcaaggtaactggttacagaaaatat
gaaaactttgaatgtattgttgaacttgaaaaaattcatcttggttacaaagtaaatgtg
gaagttaatgggattgtagatgaagtagaaatttttacttttccaaaacctgaaagaatc
tttttaaacaattggcaatcttggggaccggcaagagttgtaagcgaagatttctcaatt
gactttccaaaagaactaattcaaaaatttgggttcagtgcttccattatgccagagaaa
tactttaattcacttgtaagtgattattttatagcttctgacaattttgtgataggtgca
cttcaatctaaggtggggcatccattctttgaattggcaaaagatagtataagtgttaag
ttaaggttcttcggtaaaagttttgacggttggacaaaggttgaatcgtttgtagtgttg
tacgaaaatccagatatcgcattaccttactatgcggatttggtggcaaaagaaaacaac
gctaattacaaaagatataatccaataggatggtcaagctggtaccaatatttcttggat
tttgactacaataagatgatttcagatcttgagaaatcatatgggtacggttacgaagtc
tttcaaatagatgatgcgtgggaaagagatataggtgattgggaagtaaatgaaagattt
ccttcactcgaagaagttgcaagtaagattaaagagtacggttatactcctggagtatgg
ttggcaccttttagtgtagccgagacttcggatttatttaaaaaccatcctgaatggatt
gttaaagataacaatggaaatccgatagtcgcctatgaaaattggaataaaaaaatttac
gctctggacacaactcatccagaagcgcaaaagtggcttttgaatctttttatcgatttg
aaaagtaaagggtttgattattttaaaatcgattttctctttgctggagctatacaaggc
aaacgttacttgaatgtcactccagtggaagcttacaggattggtatggaaacgataaga
aaagctacaggcgattcttttgtccttggttgtggtgcacctttattaccaagcattgga
tatgttgatggtatgaggataagtgcggatacagcaccttactgggatttaaacggacct
gatattggttacccaaatgcttatttcgcgcttagaaatgtcattacaagatcctttatg
aacaacgtttggtggtggaacgatccagactgtttgatgcttagaaaggaagaaacacag
ctttcggataatcacagacaactttatacgtacgtttctcttttacttgataatatgatt
attcaaagtgataatctctcacttaatatagacaaagagctttggaatgttattttagag
tacaaaaaatatggtagaaggaagtacagggtcgagggtttaatggaaggtgtatacaaa
atcactagctgtggtttgaatggttgtgataagcttacaatagaagatcttggaaatgct
aagtacaaaatagaattcgatatcccaagagttaagttatttaaaagtgttgagaagaga
gaagatggaaggacgtttaattactatacggaagataatactggtaaagcaaagggtgat
gtaaaatga

DBGET integrated database retrieval system