KEGG   Fervidobacterium nodosum: Fnod_0419Help
Entry
Fnod_0419         CDS       T00579                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
fno  Fervidobacterium nodosum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Fnod_0419
Enzymes [BR:fno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Fnod_0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(456128..457957)
Genome map
AA seq 609 aa AA seqDB search
MQIYGADYYPEHWDESFWNRHIEIMKEYGIDWVRIGEFAWAVFELKEGEFHFELFDKIIK
LLKDNGINIILGTPTATPPAWLIRKFPEILPKDYNGKVREFGSRRHYSTNSKVYREYSAR
IVEEYAKRYGSIVDAWQIDNEFGCHGTTYSFTEDDRKMFIEWLKEKYGTLDNLNKAWGTV
FWSQTYSDWNEIGFPINTPTFENPHQMLDIYRFMSDSSIDYMNMQIEIIRRYSDKPITHN
FMVDFMDIDYRKMAKYLDFVSWDNYIATKEYDPLRQSANHVLMRSLKKSPFLVIEQQPGR
VNWRDVNENYPGEYLNMWTKQGYINGALGVMPFRFDQIRFAAEQYHGGLLDYAGRPTKRL
EMYSKVKSETPNVVESKKEVAIYFDYENEWIHRINHVNRKFRYWDNIIEIFKAVRKLGYN
VDFVFADDDLSEYHTLIVPYAFKIGNEFVEKIKLFKGNVYMTCMSGLKDENNWIVERAPH
MLIDEFGVEVMDFGAIDKSKANILNADFEVDYWMDELRVYDGKILGTFDNGMPLFVKKSN
RYYLASVLNEAGWLNILSRTLEPKFIGSDVEYSEAKDGIYILNLKNERNNIFIGSQIIEL
NAFELKVIK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttacggagctgattattatccagagcattgggatgagagtttttggaatagg
catatagagataatgaaagaatatggtattgattgggtaagaataggtgaatttgcctgg
gctgtttttgaactgaaagaaggagaatttcattttgaactttttgataagataataaag
cttctcaaagataatggaataaatattattttagggactccaacagcaacaccaccagct
tggcttatcagaaaatttcctgagattctcccaaaggattataatggaaaagttagagaa
ttcggaagtagaaggcactattcgacgaattcgaaagtttacagagaatactctgcacgc
atcgtagaagagtatgcaaaaagatatggttcgatagtagatgcttggcaaattgataat
gaattcggttgtcacggtactacttattcctttacagaagatgatagaaagatgtttatt
gaatggcttaaggaaaaatacggtacactggataatttgaataaagcatggggtacggtg
ttttggagtcaaacttacagtgattggaatgagataggatttccaattaatactccaact
ttcgagaatcctcatcagatgcttgatatttacaggtttatgtctgatagttccatagat
tacatgaatatgcaaattgaaattattcgaagatactcagataaaccaattacacataat
tttatggttgattttatggacatcgattacaggaaaatggctaaataccttgattttgtt
tcttgggataattacattgcaacaaaagaatacgaccctttaaggcaatctgcaaatcat
gttttgatgcgctcgttgaagaaatcaccatttcttgttatcgaacaacaacccggaaga
gttaattggcgtgatgtgaatgaaaattacccaggtgagtacctcaatatgtggacaaag
cagggatatataaacggagcacttggagttatgccctttagattcgatcaaattagattt
gcagcagaacagtatcacggtggattgttagactatgctggaagacctacaaagagattg
gaaatgtacagtaaagtaaagagtgagacaccaaatgttgttgagtcaaaaaaagaggtg
gcaatatactttgattacgaaaatgaatggattcacagaataaatcatgtaaacagaaag
ttcagatattgggataatataattgaaattttcaaagcggtaagaaagctgggatataac
gttgatttcgtttttgcagatgatgatctgtcggaataccatactctcattgttccttat
gctttcaaaatcggtaatgagtttgttgaaaaaataaagttgttcaaaggaaatgtctat
atgacttgtatgtcgggattgaaagatgagaataattggatagtcgaaagagctccacac
atgttaattgatgagtttggcgttgaagtaatggatttcggtgctattgataagtctaaa
gcaaatattttgaatgcggattttgaagtagattattggatggatgagttgagagtttac
gatggaaagattttggggacttttgacaatggaatgccgctgtttgttaaaaagtcaaat
aggtactatttggcgagcgtgttaaatgaagctggatggttgaatatactttcaagaact
cttgagccaaagttcataggtagcgatgtggaatattccgaagcaaaggatggaatatac
atattaaatcttaaaaatgagagaaataatatatttataggaagtcaaattatcgagtta
aatgcctttgaactgaaagtaataaaataa

DBGET integrated database retrieval system