KEGG   Fervidobacterium nodosum: Fnod_0742Help
Entry
Fnod_0742         CDS       T00579                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fno  Fervidobacterium nodosum
Brite
Enzymes [BR:fno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Fnod_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_3 Methyltransf_25 Fibrillarin Ubie_methyltran GCD14 Methyltransf_4 Methyltr_RsmB-F Methyltransf_23 Methyltransf_11 CMAS ACP_syn_III_C Methyltransf_32 Trans_coact DUF938
Motif
Other DBs
NCBI-ProteinID: ABS60597
JGI: Fnod0742
UniProt: A7HL14
Position
805077..805676
Genome map
AA seq 199 aa AA seqDB search
MLFEHLQYYGVSRKIIEAMNKVDRKLFVPSELQESAYLDIPLPIGYGQTISAPHMVGMMC
EYLELKDGDRVLEIGTGSGYNAAVMSLLVGESGWIYTIERIPELVQEAQKRINLLGINNI
TIIVGDGKEGLEEYAPFDKITVTCYAKHIPKKLIEQLKDNGIMVIPVGNEYVQILKLIRK
SGEKIIEEDLTHVRFVPMQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgttattcgaacaccttcaatattacggtgtttcaagaaaaattatcgaagcgatgaat
aaagttgacaggaaattatttgttccaagcgaactccaagaaagtgcttatcttgatatt
ccactccctataggatatggtcaaacaatctcagctccacatatggttggaatgatgtgt
gagtatcttgaactaaaagatggggacagagttctcgaaataggtacaggaagtggttac
aacgcagcggttatgagtttactcgttggtgaaagtggttggatatacactatcgaacga
ataccagaacttgtgcaagaagctcaaaaaagaattaatttactcgggataaataacata
accatcatcgttggtgatggtaaggaaggtcttgaagaatatgccccttttgacaaaatc
acagtaacttgttatgctaagcacattccgaaaaaattaattgagcaattgaaagacaat
gggataatggttattccagttggtaatgagtatgtccagatactaaaactaattagaaaa
tcaggagaaaaaattattgaagaagatctaactcacgtgcgatttgtaccaatgcagtag

DBGET integrated database retrieval system