KEGG   Fervidobacterium nodosum: Fnod_0742Help
Entry
Fnod_0742         CDS       T00579                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fno  Fervidobacterium nodosum
Brite
Enzymes [BR:fno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Fnod_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
805077..805676
Genome map
AA seq 199 aa AA seqDB search
MLFEHLQYYGVSRKIIEAMNKVDRKLFVPSELQESAYLDIPLPIGYGQTISAPHMVGMMC
EYLELKDGDRVLEIGTGSGYNAAVMSLLVGESGWIYTIERIPELVQEAQKRINLLGINNI
TIIVGDGKEGLEEYAPFDKITVTCYAKHIPKKLIEQLKDNGIMVIPVGNEYVQILKLIRK
SGEKIIEEDLTHVRFVPMQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgttattcgaacaccttcaatattacggtgtttcaagaaaaattatcgaagcgatgaat
aaagttgacaggaaattatttgttccaagcgaactccaagaaagtgcttatcttgatatt
ccactccctataggatatggtcaaacaatctcagctccacatatggttggaatgatgtgt
gagtatcttgaactaaaagatggggacagagttctcgaaataggtacaggaagtggttac
aacgcagcggttatgagtttactcgttggtgaaagtggttggatatacactatcgaacga
ataccagaacttgtgcaagaagctcaaaaaagaattaatttactcgggataaataacata
accatcatcgttggtgatggtaaggaaggtcttgaagaatatgccccttttgacaaaatc
acagtaacttgttatgctaagcacattccgaaaaaattaattgagcaattgaaagacaat
gggataatggttattccagttggtaatgagtatgtccagatactaaaactaattagaaaa
tcaggagaaaaaattattgaagaagatctaactcacgtgcgatttgtaccaatgcagtag

DBGET integrated database retrieval system