KEGG   Fervidobacterium nodosum: Fnod_0754Help
Entry
Fnod_0754         CDS       T00579                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fno  Fervidobacterium nodosum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fnod_0754
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Fnod_0754
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fnod_0754
Enzymes [BR:fno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Fnod_0754
Exosome [BR:fno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fnod_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(825557..826858)
Genome map
AA seq 433 aa AA seqDB search
MGKKVLTFATLLFVYFAFALNVIILVGDGMSTNQLFLASILEGRILNTMTLPYTGITTTY
SADSWVTDSAPAASALFSGFKILNKVIGVLPNGEPVPSIFELAKKAGYKIGIAVTCQITH
ATPAGVYANVDNRNDELGIAKQFVDKEVVDVAFGGGWQWFTPASKGGSRKDELDLIKAAM
EKGYKYISTVNELENISAENEKVLGLFAKNYLDPVSERSSSQPKLDLMTKKALEILSASG
KPFMLMVEGSQIDWEAHANDFYGVWKEVVEFDDAVKVALDFAKKDGNTLVIVLGDHETGG
LSLSTGGYAINVEQARKAKGTTTMFLKQFNINDKDAFIAGIKEWYGVNMSDSEYETLKKV
PSNNLRRELARYISFKVGFGWTTYDHTAQPVPVYAFGPGAENFTGVLDNTDIAKIVARLT
KITTVQFPSIVAK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaaggttttaacttttgctacgctactttttgtttattttgcttttgccctc
aacgttataattcttgttggggatggtatgtctacaaatcaactatttctcgcaagtatt
cttgaaggaagaattttaaacacgatgactcttccttacacaggtataacaacaacatac
agcgcagattcttgggttacagattcagcgccagcagcgagtgctcttttcagtgggttt
aagattttgaataaggtgataggggtgcttccaaatggtgaacctgttccatccatattt
gaacttgccaagaaagcaggttacaaaatagggatagcggttacatgccaaattactcac
gcaacaccagcgggcgtttacgcaaatgttgataacagaaacgatgagcttggaattgcg
aaacaatttgttgataaagaagtggtagatgttgcgtttggtggaggatggcaatggttt
acacctgcttcaaaaggtggttcaagaaaagacgaacttgatttgattaaagctgctatg
gaaaaaggttataaatacatatcaacagtaaatgaattggaaaatatcagcgcagagaat
gaaaaagttcttggcttatttgctaaaaattatttagacccagtatctgaaagaagctca
tcgcaacctaaactcgatctcatgacaaagaaagctttagaaattctctccgcaagtgga
aaaccatttatgctcatggttgaaggttcgcaaatcgactgggaagcgcacgccaacgat
ttctatggtgtatggaaagaagttgtcgaatttgatgacgcggttaaggtcgctcttgat
tttgccaagaaagatggaaacacacttgtgattgtccttggtgaccatgaaacaggtggt
ttatcactttccacaggtggatatgcgataaacgttgaacaagcgagaaaagcaaaggga
acaacaacgatgtttttaaaacaatttaatataaacgataaagatgcgttcatcgctgga
ataaaagaatggtacggtgtaaatatgagcgattccgaatatgaaacactcaagaaagtt
ccatcaaataacttaagaagagaactcgcaagatacattagtttcaaagtcggttttggt
tggacaacgtacgaccacaccgcgcaacctgtaccagtatatgcctttggacctggcgct
gagaacttcacaggagtacttgacaatacagatatagcgaaaattgttgcgaggttaaca
aagataacaactgttcaattcccatctatcgttgcaaaataa

DBGET integrated database retrieval system