KEGG   Fervidobacterium nodosum: Fnod_0857Help
Entry
Fnod_0857         CDS       T00579                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
fno  Fervidobacterium nodosum
Brite
Enzymes [BR:fno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Fnod_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(931442..932209)
Genome map
AA seq 255 aa AA seqDB search
MDFGNYKTVKISEPIFLKGGDIGVLLVHGYTGSPHDFSYMANELNKAGFTVSVPRLPGHG
TCGEDFLKTNADDWLRRAFDAYYDLQGMCKEVYICGLSMGGVISLIMAAQLKPKKLVTLA
AATHVFDNRIKLTPLLALFKEKMPRENNEKYEDPDLEYLRKEYWSYNWPKQAAELYKLMK
ISRKSVTQIISDTLVVAARNDNTVPLSAAEFIYNNIRSERRKLLVFERSGHVLSNDIEKE
AVTEAVKNWFLGIEA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttggactttggaaattacaaaacagtaaaaatttcagaacctatattcttgaaaggtggg
gatataggggtattgttagtccatggttatacaggttcaccacacgatttttcttatatg
gcaaacgagttaaataaagccggttttacagtttccgtgccaagactgcctggtcatggg
acatgtggagaagatttcttaaagacaaacgcagacgattggctaagaagagcttttgat
gcgtattatgatttgcaagggatgtgtaaagaagtatatatttgtggtctatctatggga
ggagtaattagcctcatcatggcagctcaattaaaaccaaaaaaattagtcacattagct
gccgctacgcatgtatttgataatcgaataaaacttacacctttgctagccttgtttaaa
gaaaaaatgccacgtgaaaataacgaaaagtacgaggatccagatttggaatatctcaga
aaagaatactggtcttacaactggcccaaacaagccgcagagctttataagttgatgaaa
atctcaagaaaaagtgttacacaaattatttctgataccttggtagttgcggcaagaaac
gataatactgttcccttaagtgctgcagaatttatttataataacattcgatcagagaga
agaaaactcttggtgtttgaacgttccggtcatgtgttaagcaacgatattgagaaagaa
gcggttacggaagctgttaaaaattggttcttgggtattgaggcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system