KEGG   Fervidobacterium nodosum: Fnod_1076Help
Entry
Fnod_1076         CDS       T00579                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fno  Fervidobacterium nodosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Fnod_1076
Enzymes [BR:fno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Fnod_1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1175872..1176915
Genome map
AA seq 347 aa AA seqDB search
MSKEKKEKLTTKDLLLKFSAIPGPSGYEDEVLEEIKTIMSDYSDECFRTPMGSLVCVKKG
AGPKIGFFAHADQIAFVVTKIYEDGFLRLSGVGGWDPKTVVSQKVWIHTKKGKLRGIVGF
MPPHLQTTEESKKVPDYDHLFVDVTMNPNWKDISIGDLVTLDIEGFEKNGTIFAPALDNR
ASCVAIIKAAELLSKINTQAQVYYIFSTQEEIGGPGAKSGAYISEIEYGIVIDVTHGDED
IPGYPKIKMGEGPAVAVGPVTNKKFVEHINKVAGKYNIKLQIEPIPGRSGTDTDEVQLTR
IGVKTALISIPLKYMHNPYEKITVKDVEDTAKLLAFTAAEITEVEKQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaagagaaaaaagaaaaattaactacaaaagacttacttttaaaattttcagct
attccaggaccttctggatacgaagatgaagtccttgaagaaataaaaacaattatgagt
gattattccgacgagtgtttccgaacacctatgggcagccttgtgtgtgttaaaaaaggc
gcgggaccgaagattggtttttttgctcatgctgaccagatagcgtttgtcgttacgaaa
atatacgaagatggatttttgagactttcaggcgttggtggatgggatccaaaaacagtt
gtaagccaaaaagtatggattcacacaaagaaaggaaaattaagaggtatagttggcttt
atgcctccgcacctccaaacaacggaagagtcgaaaaaagtaccagattatgaccattta
ttcgtcgacgttactatgaacccaaattggaaggatatatcgataggtgatctggtaact
ttagatatagaaggatttgagaaaaacgggacgatattcgcgccagcacttgataacaga
gcaagttgtgtggccataatcaaggcggctgagttactctcaaaaattaatacacaagcc
caggtttattatatattctcaacccaagaagagatagggggaccaggtgcgaaaagcggt
gcgtacatttcagagatagaatacggcatagtcatagatgttacacatggtgatgaggat
atacctggttatcctaagataaagatgggcgaaggaccagccgttgctgttggacctgtt
acaaataaaaaatttgtggagcatataaacaaagtagctggaaaatacaacataaagctc
caaatagaacccataccgggaaggtctggaacagacaccgacgaagtccaacttacgaga
ataggtgttaaaacagctttgatatctatacctctaaaatacatgcacaacccatacgaa
aaaattacagttaaagacgtcgaagacacagccaaattacttgcattcacggcagctgaa
atcacggaggtggaaaagcaatga

DBGET integrated database retrieval system