KEGG   Fervidobacterium nodosum: Fnod_1077Help
Entry
Fnod_1077         CDS       T00579                                 

Definition
(GenBank) Cellulase
Organism
fno  Fervidobacterium nodosum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1176912..1177922
Genome map
AA seq 336 aa AA seqDB search
MMKYLKELTELKGVSGFEDDVREYIKEKIKDKVDELFVDRMGNLIALKKGNGKGKKILLD
AHMDEVGFMVTNINEDGTLSFAPVGGVDPRVIIGKKVQVGKESIGVIGYKAVHIQREGMM
NTPKYSELKIDIGAKSKQEAEKQVKIGDMVAFTTNYEESGDFVIAKALDDRCGCSVLMDL
IDELSNKNSLPNDVYFAFTVQEETGLRGPAIIAEQLKVDMAIAVETTTSGDDPELEKQLW
STHLGNGPAITFMHSGYVVHQEIFEKLVQIAKENNIPFQYKMRTVGGTNARRYAITGIPA
GVVSVPARYIHSPVSSINKNDYKHTLNLLEMFLEKE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtatttaaaagaactcacagaattaaagggagtttctggatttgaagatgat
gtaagggaatatataaaagagaaaataaaagataaagtggatgaattgtttgtagataga
atgggaaatctaatagcgctaaagaaaggcaatgggaaaggtaagaaaatattgcttgat
gcacatatggacgaggttggatttatggtaactaacatcaacgaagatggtacattatca
ttcgcgccagttggtggcgttgacccaagggttataattggtaaaaaagttcaagttggt
aaagaatcaataggcgtgataggttacaaagccgtccacattcaaagagaaggaatgatg
aacacacccaaatactcagaacttaaaatagacataggagcgaaatcaaaacaagaagcg
gaaaaacaagtcaaaataggtgatatggtggcgtttacaacaaattacgaagaatctgga
gacttcgtaattgcgaaagctcttgatgacagatgtggttgtagtgtgcttatggattta
atagatgaattatcaaataaaaattcgttgccaaacgacgtttactttgctttcactgtc
caggaagagacaggcttaagaggccctgcaataatagcggaacaattaaaagttgacatg
gcgatagccgtcgaaacaacaacaagtggtgacgacccagaacttgaaaagcaactttgg
tccactcaccttggtaacggtcctgcgataacatttatgcacagtggatacgttgttcat
caagaaatatttgaaaaactcgtccagatagccaaggaaaacaatataccattccaatac
aaaatgcgcacagttggaggcacaaacgcaagaagatacgctataactggaatacctgcg
ggagttgtatcagttcctgcaagatacattcacagtccagtctcgtcgataaataaaaac
gattacaagcatacgttaaatttgttagaaatgtttcttgaaaaagaataa

DBGET integrated database retrieval system