KEGG   Fervidobacterium nodosum: Fnod_1077Help
Entry
Fnod_1077         CDS       T00579                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fno  Fervidobacterium nodosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Fnod_1077
Enzymes [BR:fno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Fnod_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1176912..1177922
Genome map
AA seq 336 aa AA seqDB search
MMKYLKELTELKGVSGFEDDVREYIKEKIKDKVDELFVDRMGNLIALKKGNGKGKKILLD
AHMDEVGFMVTNINEDGTLSFAPVGGVDPRVIIGKKVQVGKESIGVIGYKAVHIQREGMM
NTPKYSELKIDIGAKSKQEAEKQVKIGDMVAFTTNYEESGDFVIAKALDDRCGCSVLMDL
IDELSNKNSLPNDVYFAFTVQEETGLRGPAIIAEQLKVDMAIAVETTTSGDDPELEKQLW
STHLGNGPAITFMHSGYVVHQEIFEKLVQIAKENNIPFQYKMRTVGGTNARRYAITGIPA
GVVSVPARYIHSPVSSINKNDYKHTLNLLEMFLEKE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtatttaaaagaactcacagaattaaagggagtttctggatttgaagatgat
gtaagggaatatataaaagagaaaataaaagataaagtggatgaattgtttgtagataga
atgggaaatctaatagcgctaaagaaaggcaatgggaaaggtaagaaaatattgcttgat
gcacatatggacgaggttggatttatggtaactaacatcaacgaagatggtacattatca
ttcgcgccagttggtggcgttgacccaagggttataattggtaaaaaagttcaagttggt
aaagaatcaataggcgtgataggttacaaagccgtccacattcaaagagaaggaatgatg
aacacacccaaatactcagaacttaaaatagacataggagcgaaatcaaaacaagaagcg
gaaaaacaagtcaaaataggtgatatggtggcgtttacaacaaattacgaagaatctgga
gacttcgtaattgcgaaagctcttgatgacagatgtggttgtagtgtgcttatggattta
atagatgaattatcaaataaaaattcgttgccaaacgacgtttactttgctttcactgtc
caggaagagacaggcttaagaggccctgcaataatagcggaacaattaaaagttgacatg
gcgatagccgtcgaaacaacaacaagtggtgacgacccagaacttgaaaagcaactttgg
tccactcaccttggtaacggtcctgcgataacatttatgcacagtggatacgttgttcat
caagaaatatttgaaaaactcgtccagatagccaaggaaaacaatataccattccaatac
aaaatgcgcacagttggaggcacaaacgcaagaagatacgctataactggaatacctgcg
ggagttgtatcagttcctgcaagatacattcacagtccagtctcgtcgataaataaaaac
gattacaagcatacgttaaatttgttagaaatgtttcttgaaaaagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system