KEGG   Fervidobacterium nodosum: Fnod_1210Help
Entry
Fnod_1210         CDS       T00579                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
fno  Fervidobacterium nodosum
Pathway
fno00010  Glycolysis / Gluconeogenesis
fno00052  Galactose metabolism
fno01100  Metabolic pathways
fno01110  Biosynthesis of secondary metabolites
fno01120  Microbial metabolism in diverse environments
fno01130  Biosynthesis of antibiotics
Module
fno_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fnod_1210
   00052 Galactose metabolism
    Fnod_1210
Enzymes [BR:fno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Fnod_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABS61057
JGI: Fnod1210
UniProt: A7HMC4
Position
complement(1302482..1303525)
Genome map
AA seq 347 aa AA seqDB search
MFFGSIDKREFGATTEGIAVQEYTLVNKNGVMMKVLTYGGIIRELWVPDKNGNFVDIVLG
FDSLEEYERNPGYLGALIGRFANRIAYGKFEIDGVTYQLALNDKGRPNALHGGYKGFNKK
VWKAFDEITPNGPILTLKYFSHDGDEGFPGDLDVSVTYTLTNENELKIDYTATTNRPTIV
NLTQHTYFNLAGGGKIYDHIVVLNADKYTPVNENLIPTGDIMPVEDTLYDLRKETRLGDA
IEKLKNSNAKGYDNNFVLNSEFAAKVYEPSTGISMELYTTQPGLQFYTGNYLPGLNGKRG
QNYDAHTGFCLETQHFPDSPNHENFPNTVLRPGEIYKHRSVFKFGII
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttctttggctcaatagacaaaagagaattcggtgcaactaccgaaggtatagccgtg
caggaatatacattagtgaataaaaacggagttatgatgaaggtcttaacatacggagga
atcataagggaactatgggttccagataaaaatgggaattttgtggatatagtccttgga
ttcgattctttagaagaatacgaaagaaatccaggttatcttggggctttaataggaaga
ttcgcaaatagaatagcttacggaaaatttgaaatagatggcgtaacttatcaattggct
ttgaacgataaaggaaggccaaacgctttacacggcggatataagggattcaataaaaaa
gtttggaaagcttttgatgagataacgccaaacggcccaatcctaactttgaaatatttt
agccatgatggtgacgaaggcttcccaggggacttagatgtttctgttacttacacacta
acaaacgagaacgagcttaaaattgattacacggccacaacaaatagacctacgatagtt
aatctcacccaacatacctattttaacttagctggtggtggaaaaatatacgatcatatt
gttgttttgaatgccgataaatacacgcctgttaatgaaaatctaattccaactggtgat
attatgcctgttgaagatactttatacgatttgaggaaggaaacaaggcttggagacgca
atagaaaaattgaaaaattcaaatgctaaaggttacgacaacaacttcgtattgaattct
gaatttgccgcgaaagtatatgaaccatcaactggtatatcaatggaactctacacgact
cagccaggtcttcaattctatacaggtaattatttgccgggattaaatggaaaaagagga
cagaattacgatgcacatacgggattttgtcttgaaacacaacattttccagattcacca
aaccatgaaaacttcccaaacacggtgctaagaccgggagaaatttataagcatcgttct
gtttttaagtttggtatcatttaa

DBGET integrated database retrieval system