KEGG   Fervidobacterium nodosum: Fnod_1254Help
Entry
Fnod_1254         CDS       T00579                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fno  Fervidobacterium nodosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fnod_1254
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fnod_1254
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fnod_1254
Enzymes [BR:fno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fnod_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1355296..1356549
Genome map
AA seq 417 aa AA seqDB search
MREKVYLKFEEMPKVYYNVLADLPFELDPPLDPETNKPISPEKLLAIFPEPLLEQEVSKE
RFIPIPEPVLKEYAVYRPTPLVRATFLEEYLRTRTKIYYKYEGVSPTGSHKVNTAIAQAY
YNKIAGTKTLVTETGAGQWGSALSYAGQKFGLDVRIFMVKVSYQQKPFRKILMNLFGGDV
QPSPSNLTQIGRQFSEDHPGTLGIAISEAIHTVLNEKDAKYSLGSVLNHVLLHQTIIGLE
MKKQLEIIGIKPDIIVACHGGGSNFGGSALPFIPDVLSGKNIKIVAVEPESCPSLTKGEY
RYDFGDTAGLTPLMKMYTLGKDFVPPAIHAGGLRYHGASPIVSKLYHERLIDAASVTQEE
VFEAGKLFAKLEGIVPAPESAHAIAYVIKEAKKGDKESIVFTLSGHGYFDLNAYINQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaaagtatatctaaagtttgaagagatgccaaaggtgtattacaacgtttta
gcggatttgccatttgaacttgacccaccacttgatccagaaacaaataaacctatttct
ccagagaaacttttagcgatattcccagagccattacttgagcaagaagttagcaaagaa
agatttattccaatacctgagcccgtgcttaaagagtatgcagtataccgtccaacgcca
cttgtcagagcaacattcttggaagaatatctcagaacaagaacaaaaatatactataag
tacgaaggagtaagccctactggtagccacaaggttaacacagccatcgctcaagcttat
tacaataaaatcgccggaactaaaacactcgtaacggaaacaggcgcaggacagtggggg
agcgcactctcatatgcaggtcaaaaattcggacttgacgtgcgcattttcatggttaag
gttagttaccaacaaaaaccatttcgaaagatacttatgaatttatttggtggagatgtt
cagccaagtccaagtaacttaacgcaaatagggaggcaatttagcgaagaccatccaggg
acattaggtatagccatatctgaagcaatccatacagttttaaacgaaaaagatgcaaaa
tactctcttggaagtgttttaaaccatgtgcttttgcaccaaactatcatcggacttgag
atgaaaaaacagcttgagataataggaataaaacctgatataattgttgcctgtcacggt
ggtggctcaaacttcggtggtagtgctcttcctttcataccagatgtgctatcaggaaaa
aacataaagattgtggctgtggaaccggaaagttgtccatcgcttacaaaaggtgagtac
agatacgatttcggtgacactgcaggattaacacctttaatgaaaatgtacacattaggc
aaagacttcgtaccaccagcaatccatgccggtgggttaagataccacggcgcttcaccc
atagtttcaaaactttaccatgaaagacttatcgacgcggctagcgtaacccaagaagaa
gtcttcgaagctggaaaattatttgcaaaactcgagggaatagttcctgcccctgaatct
gcccacgcaatcgcgtatgttataaaagaagctaaaaaaggtgataaagagagcatcgta
ttcacattatcaggacatggatactttgatttaaacgcttatataaatcaatga

DBGET integrated database retrieval system