KEGG   Fervidobacterium nodosum: Fnod_1254Help
Entry
Fnod_1254         CDS       T00579                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fno  Fervidobacterium nodosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fnod_1254
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fnod_1254
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fnod_1254
Enzymes [BR:fno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fnod_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1355296..1356549
Genome map
AA seq 417 aa AA seqDB search
MREKVYLKFEEMPKVYYNVLADLPFELDPPLDPETNKPISPEKLLAIFPEPLLEQEVSKE
RFIPIPEPVLKEYAVYRPTPLVRATFLEEYLRTRTKIYYKYEGVSPTGSHKVNTAIAQAY
YNKIAGTKTLVTETGAGQWGSALSYAGQKFGLDVRIFMVKVSYQQKPFRKILMNLFGGDV
QPSPSNLTQIGRQFSEDHPGTLGIAISEAIHTVLNEKDAKYSLGSVLNHVLLHQTIIGLE
MKKQLEIIGIKPDIIVACHGGGSNFGGSALPFIPDVLSGKNIKIVAVEPESCPSLTKGEY
RYDFGDTAGLTPLMKMYTLGKDFVPPAIHAGGLRYHGASPIVSKLYHERLIDAASVTQEE
VFEAGKLFAKLEGIVPAPESAHAIAYVIKEAKKGDKESIVFTLSGHGYFDLNAYINQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaaagtatatctaaagtttgaagagatgccaaaggtgtattacaacgtttta
gcggatttgccatttgaacttgacccaccacttgatccagaaacaaataaacctatttct
ccagagaaacttttagcgatattcccagagccattacttgagcaagaagttagcaaagaa
agatttattccaatacctgagcccgtgcttaaagagtatgcagtataccgtccaacgcca
cttgtcagagcaacattcttggaagaatatctcagaacaagaacaaaaatatactataag
tacgaaggagtaagccctactggtagccacaaggttaacacagccatcgctcaagcttat
tacaataaaatcgccggaactaaaacactcgtaacggaaacaggcgcaggacagtggggg
agcgcactctcatatgcaggtcaaaaattcggacttgacgtgcgcattttcatggttaag
gttagttaccaacaaaaaccatttcgaaagatacttatgaatttatttggtggagatgtt
cagccaagtccaagtaacttaacgcaaatagggaggcaatttagcgaagaccatccaggg
acattaggtatagccatatctgaagcaatccatacagttttaaacgaaaaagatgcaaaa
tactctcttggaagtgttttaaaccatgtgcttttgcaccaaactatcatcggacttgag
atgaaaaaacagcttgagataataggaataaaacctgatataattgttgcctgtcacggt
ggtggctcaaacttcggtggtagtgctcttcctttcataccagatgtgctatcaggaaaa
aacataaagattgtggctgtggaaccggaaagttgtccatcgcttacaaaaggtgagtac
agatacgatttcggtgacactgcaggattaacacctttaatgaaaatgtacacattaggc
aaagacttcgtaccaccagcaatccatgccggtgggttaagataccacggcgcttcaccc
atagtttcaaaactttaccatgaaagacttatcgacgcggctagcgtaacccaagaagaa
gtcttcgaagctggaaaattatttgcaaaactcgagggaatagttcctgcccctgaatct
gcccacgcaatcgcgtatgttataaaagaagctaaaaaaggtgataaagagagcatcgta
ttcacattatcaggacatggatactttgatttaaacgcttatataaatcaatga

DBGET integrated database retrieval system