KEGG   Fervidobacterium nodosum: Fnod_1351Help
Entry
Fnod_1351         CDS       T00579                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
fno  Fervidobacterium nodosum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:fno01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fno01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fno00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:fno00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:fno00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fno00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:fno00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1454392..1455321
Genome map
AA seq 309 aa AA seqDB search
MIFTLTMNPCLDRYIYVDDLIVDDTIRAKKIVDYPAGKGIDVSRVIRELGGVSIAIALVG
GDTGRKLEEMLDKEGVIYSSIRVPQETRMNIILESNKGQYRISMPGEKISVKKLQVVLEV
LQALVREKDVVVVSGSLPKGVAAEFYTGIIFTLKQWGATVYFDADGDKLKAGLIGQPDYI
KPNLHEFQRLIGKHVSTREEIISEAKKIIDIHELQGILLTLGGEGAYLITKEKVLFTKTI
KVNVKSAVGAGDSFLAGFVFKKAEDASDEEALRWANAAGTAAVMTPGTRLCRKADVERLI
DRIEVERIE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgattttcactctaactatgaatccatgccttgataggtacatttatgttgatgatttg
atcgttgatgatactataagggcaaagaaaatagttgattaccctgcaggaaaaggtatc
gatgtttcgagggttatcagagaacttggaggagtttctatagctatcgcactcgttgga
ggagatactggcagaaaactcgaagagatgcttgacaaggaaggggttatatacagctcg
atcagagttcctcaagaaacgaggatgaatataattttagagtcaaacaaagggcagtat
agaataagtatgcccggggaaaagattagcgttaaaaaactacaagttgtcctcgaagtt
cttcaagcgcttgttcgagaaaaagatgttgttgtagtttcaggtagtcttccgaaaggc
gttgctgcagaattctacacggggattatctttacgctcaagcaatggggagcaactgtt
tacttcgatgctgatggagacaagctaaaagcaggactaatcggtcaacctgactatata
aagcctaacttacatgaatttcaaagacttattggaaagcacgtaagtactcgtgaggaa
ataataagtgaagcaaagaaaattatagacatccacgagcttcaaggtattctgcttaca
cttggtggagagggtgcgtatcttatcacaaaagaaaaagtattgttcacaaaaacaata
aaagttaatgtaaaaagtgccgtaggcgcgggtgactcgttcctagctggatttgttttt
aaaaaggcagaagatgcaagcgatgaagaagcgttaagatgggcaaatgccgcgggaact
gcagcagttatgacccctggtaccagattgtgtagaaaagcagatgtagaaagattaata
gatagaatagaagtggaaagaattgagtaa

DBGET integrated database retrieval system