KEGG   Fervidobacterium nodosum: Fnod_1378Help
Entry
Fnod_1378         CDS       T00579                                 

Definition
(RefSeq) succinate--CoA ligase (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fno  Fervidobacterium nodosum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fnod_1378
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fnod_1378
   00640 Propanoate metabolism
    Fnod_1378
   00660 C5-Branched dibasic acid metabolism
    Fnod_1378
Enzymes [BR:fno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Fnod_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1486127..1487194
Genome map
AA seq 355 aa AA seqDB search
MKIQEYVGKRLLSEHGFYVPRSLFVKEEDIDSKELTQKILELGFPQVLKSQVLVGGRMKA
GGVIIAKNLEESMRALRELVNKEIKGEMPEGVLIEEFVKHDKELYFGITIDRTNRNILMI
YSEFGGVDIEEASRMFPNKVLKTYSFNDLPEEFKETAKVLLDIFKKLDLTLLEINPIGVT
KSGYVMLDAVMHVDDNALFRQSWAMEQMNERENDMVLLGGSYGVIGCGAGIVMATIDMLK
EFGFEPANFYDVGGGATRENVLEALKKVSRISKKIVLNIFGGITDCFQVAEAIVLFKERH
PDVELFLRISGNKEEEARALLSNIGLTAVSDMNELIMLIQKEEAKKKELMKDVLF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcaagagtatgtggggaaaagacttttgagcgaacatggtttttatgtacca
aggagcttatttgtcaaagaagaggatatcgattcgaaggaactcactcaaaagattttg
gagctcggctttccacaggttttgaaatctcaggttcttgttggaggaaggatgaaagct
ggaggggtaatcatcgcaaagaacttggaagaaagtatgagagcgttgcgagagcttgtg
aataaagagataaaaggtgaaatgccggaaggagtattgattgaagaatttgtgaaacac
gacaaagagttgtactttggtattacgatcgataggacgaatagaaatatattgatgatt
tattctgagtttggtggtgttgatatagaggaagcatcacgaatgtttccaaataaggtt
ttgaaaacttattcatttaacgatttaccggaagaatttaaagagaccgccaaggtattg
ttggatatctttaaaaaacttgacttaacgcttttagaaatcaacccaattggagttacc
aaaagtggttatgtgatgcttgatgcagtaatgcatgttgatgataatgcattatttagg
caaagttgggcgatggagcagatgaatgaaagagaaaatgatatggtgttactcggcggt
tcgtatggggttataggttgtggcgcaggaattgttatggcaacgatagatatgttaaaa
gaatttggttttgagcctgccaatttttacgacgttggtggtggcgcgacccgtgagaat
gttttggaagcactgaaaaaggtttcaagaatttctaaaaagatagtgcttaatattttt
ggtggcataacagattgcttccaagttgctgaggcgatagttttgtttaaagaaagacat
ccggatgtcgaactgtttttaaggatttctgggaataaggaggaagaggcaagagcgtta
cttagtaatattggtttgacagctgttagtgatatgaacgaattgataatgttaatccag
aaagaagaggcaaagaaaaaggagttgatgaaagatgttcttttctaa

DBGET integrated database retrieval system