KEGG   Fervidobacterium nodosum: Fnod_1542Help
Entry
Fnod_1542         CDS       T00579                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fno  Fervidobacterium nodosum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fnod_1542
   00670 One carbon pool by folate
    Fnod_1542
Enzymes [BR:fno01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Fnod_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1674300..1674893)
Genome map
AA seq 197 aa AA seqDB search
MFLGAFSFFMVKLIGIYFQKVGEAMRVRLLAVTDIHGVIATMESDDISWGSREDKALFKE
ITTSSGVVVMGRKTFESIGKKLPNRFNVVLTKKTIEYFENLDYKPDLILSCSSREAVETL
NKMGYNDICVIGGQSVFTQFLNEGIVTDIHLTIEPVILPGNFYLFSNEITRKFDLILQNI
RKLNDVGTINIHYIIKY
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcggcgctttttcattctttatggtaaaattaattggaatatattttcaaaaa
gtaggtgaagctatgcgcgtaaggcttttagctgtcacagatatccacggtgttatagct
acaatggaaagcgatgacattagttgggggagtagagaagataaggctttatttaaagaa
attaccacaagttctggcgttgtagttatggggcgaaagacatttgaaagcattggaaaa
aaactccctaatagatttaatgttgtgttgactaaaaaaacaattgaatattttgaaaat
ttagattataaacctgatttaatactatcttgtagttctcgtgaggcggttgaaacatta
aataagatgggatataatgatatttgcgttattggtggtcaaagtgttttcactcaattt
ctaaatgaaggtatagttactgacatccatcttaccattgaacctgtaattttacccggc
aatttttacttattttccaatgaaatcacaagaaaattcgatttaattctacaaaatata
aggaaattgaacgatgttgggacaataaacatacattacattataaaatactga

  All links  
No link information was found.   
DBGET integrated database retrieval system