KEGG   Fervidobacterium nodosum: Fnod_1550Help
Entry
Fnod_1550         CDS       T00579                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fno  Fervidobacterium nodosum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fnod_1550
   01230 Biosynthesis of amino acids
    Fnod_1550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fnod_1550
   00030 Pentose phosphate pathway
    Fnod_1550
   00051 Fructose and mannose metabolism
    Fnod_1550
   00052 Galactose metabolism
    Fnod_1550
  Energy metabolism
   00680 Methane metabolism
    Fnod_1550
Enzymes [BR:fno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Fnod_1550
Protein phosphatases and associated proteins [BR:fno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Fnod_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1684386..1685654)
Genome map
AA seq 422 aa AA seqDB search
MKNEKYGKIFYKLLILKIIEAKEEGIVFMKALYAQSGGVTSVINASAYGVIDEARKNGLE
ILVGINGVTGILKENFLDASDLDIEFLRYTPAGAFGSCRKKMKNDSDIEKLFEIFRKNEI
RYFFYNGGNDSMDTAWRVQMEAQKRGYELKVVGVPKTIDNDLPHTDHCPGYGSAAKYIAI
SMMEAALDLRSMYVDSTQVFVMEIMGRHAGWLAAAAGLGWINGIGADVILLPEKPFNKDE
FLSTVNKIISEKGYCAIAVAEGLKYPDGFFVSDMGFTDSFGNRQLGGVGFTIAGMVRSEL
GLKTHVAIPDYLQRSGRHIASKTDIEEAEMCGRMAVRYALEDNYGVMVTMERVSNNPYQI
KYSSVPLNLVADQTKMLPKDFYEGYTVTDKFFEYALPLISGEFYPPFENGLPSYKLINLG
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaaaatatggtaaaatattttataagttattgatattgaaaataattgaa
gcaaaagaggaggggattgtatttatgaaagctttatacgcacagtctgggggagttaca
agcgtaatcaacgcaagtgcatacggtgtaattgatgaagctagaaagaacggattagag
atactagttggaatcaacggtgttactggcatattgaaagaaaactttttggacgctagt
gatcttgatattgaatttctcagatacactcccgcgggtgcctttggttcttgcaggaaa
aagatgaaaaatgattctgatatagaaaagttgtttgagatttttagaaaaaatgaaata
agatatttcttctataacggtggtaacgattcaatggatacagcttggcgtgttcaaatg
gaagctcaaaaaagaggatatgaactcaaggtagttggtgtccccaaaactatcgataat
gatttaccccatacagaccattgccctggctatggctccgccgcaaaatatatagcgata
tcgatgatggaagccgccctcgatttaagaagcatgtacgtcgactcaacgcaagttttt
gtaatggaaataatgggaaggcatgcaggttggcttgctgctgctgctggtcttggatgg
attaacggaataggtgcagatgtgatactccttcccgaaaaaccgttcaataaagatgaa
tttctaagcactgtgaacaaaattatctcggaaaagggatactgtgcaattgccgtagcc
gaaggtttaaaataccctgatggattttttgtctccgatatgggcttcacagatagcttt
ggaaatagacaacttggaggcgttgggtttacaatagccggtatggtaaggtcagaactg
ggtcttaaaacacacgtagccattccagattacctacaaaggagtggcagacatatagcg
agtaagacagatatagaagaagcagagatgtgtggacgtatggctgtaagatacgcactt
gaagacaattatggtgttatggtaactatggaacgagtgtcaaataatccctatcaaatt
aaatatagcagtgtcccactgaatttagttgccgatcaaacaaagatgttaccaaaagat
ttctacgaaggctatactgtaaccgataaattctttgaatacgcgctgccactcatatct
ggtgagttctatccaccatttgaaaatggattgccaagttacaaactcataaatctagga
aaaaagtaa

DBGET integrated database retrieval system