KEGG   Fervidobacterium nodosum: Fnod_1560Help
Entry
Fnod_1560         CDS       T00579                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fno  Fervidobacterium nodosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fno00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1698601..1699632
Genome map
AA seq 343 aa AA seqDB search
MKKKILNVLLGFALIFLMNGNCKADQSVSNVDKSSAFEYNKMIGHGINMGNALEAPVEGS
WGVYIEDEYFKIIKERGFDSVRIPIRWSAHISEKYPYEIDKFFLDRVKHVVDVALKNDLV
VIINCHHFEELYQAPDKYGPVLVEIWKQVAQAFKDYPDKLFFEIFNEPAQNLTPTKWNEL
YPKVLGEIRKTNPSRIVIIDVPNWSNYSYVRELKLVDDKNIIVSFHYYEPFNFTHQGAEW
VSPTLPIGVKWEGKDWEVEQIRNHFKYVSEWAKKNNVPIFLGEFGAYSKADMESRVKWTK
TVRRIAEEFGFSLAYWEFCAGFGLYDRWTKTWIEPLTTSALGK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaatattgaatgttttgcttggttttgctttaatttttcttatgaatggt
aattgcaaagctgaccaaagtgtgagtaatgttgataaaagtagtgcttttgaatataat
aaaatgattggacatgggataaacatggggaatgctttagaagcccctgtagaaggttct
tggggagtttatattgaggatgaatattttaaaataataaaagaaagaggctttgattct
gtaaggattcctatcagatggtctgcacacatttctgagaagtatccttacgaaattgat
aaattctttttagacagagtgaaacacgttgtcgatgtcgcgttgaagaatgatttggtt
gtaataatcaattgtcatcatttcgaggaattatatcaagcccctgataaatatggtcct
gtattagttgaaatttggaaacaagttgcccaagcttttaaagattatccagacaaattg
ttctttgaaatatttaacgaaccagctcaaaatttgactccgactaagtggaatgagctt
tatccaaaagttttaggtgaaattcgaaaaacgaatccatcaagaattgtaattatagac
gttccaaattggtcgaactacagctacgtaagagagttaaagcttgttgatgataaaaat
ataattgtttcattccattattacgaaccttttaattttactcaccaaggtgctgaatgg
gttagtccaacgcttccaattggcgttaaatgggaaggaaaagattgggaagtggaacag
attagaaatcatttcaaatatgttagtgagtgggcaaagaaaaacaatgttccgatattt
ttaggtgagtttggcgcatattcaaaagcagatatggaatcacgggtgaaatggaccaaa
actgttaggagaatcgctgaagaattcggattttcgcttgcatattgggaattttgtgcg
gggttcgggttgtacgatagatggacaaaaacatggatagaacctcttactacctctgca
cttggaaaataa

DBGET integrated database retrieval system