KEGG   Fervidobacterium nodosum: Fnod_1702Help
Entry
Fnod_1702         CDS       T00579                                 

Definition
(GenBank) peptidase M42 family protein
Organism
fno  Fervidobacterium nodosum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1852774..1853799
Genome map
AA seq 341 aa AA seqDB search
MAKSMNLADLVKRLTMAKSPSGRESEITNIILEELEGYIDGYKIDKLGNLIVWKNGKSDK
KILLDAHMDEIGVVVTNIDDRGFLKIDRVGGVSPYTIYQSRLKFGDIIGIVGVEGETSEE
LQFNIQKLSFEKLFVDIGAKSREEAEKICPIGTFGTFDSYFYKQGEYMVSKSMDDRIGCA
VLIETLRRLGSPKNTIYGVFAVQEEVGLIGAYVAGYDINPDVAVALDVTAVGDTPKGMKR
IPMELGKGACIKVKDMASISNRHIVNKLKEIAEKYNIPHQMEVLIFGGTDAAGYQATKAG
IPSATISIPTRYIHTPSEMVFEPDVEASIQLTMKYCEEGLE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatctatgaatttagcagatttggtaaaaagattaacgatggcgaaaagtcca
agtggacgagagtcggaaattacgaacattattcttgaagagcttgaggggtacatcgat
ggttacaaaatagacaaacttggaaacctcatagtatggaaaaatggaaagagcgataag
aaaatattactcgacgcacatatggatgaaataggagttgttgtgacaaatattgacgac
agaggctttttaaaaatagacagggtgggtggagtttcgccttatacaatttaccaatcg
agattgaaatttggtgatattataggtattgtgggcgttgaaggcgaaacgtccgaagaa
ttgcaatttaatattcaaaagttatcatttgagaagttatttgttgacataggtgcaaaa
tcgagagaagaagcggaaaagatatgtccaatagggacgtttggaacatttgacagctat
ttttacaagcaaggtgaatacatggttagtaaatccatggatgatagaataggttgcgct
gttttaatagagacgcttagaaggttaggttcgccgaagaataccatatacggcgtattc
gcggtacaagaagaagtagggcttataggtgcttacgttgccggttacgatataaatcca
gacgtagcggtagctcttgacgttaccgctgttggagacactccaaaaggtatgaagaga
ataccaatggaattgggtaaaggcgcatgtataaaggtgaaagacatggcctctataagt
aacagacatatcgttaacaagctcaaagaaattgctgaaaagtataacataccgcatcaa
atggaagtactaatattcggtggaactgacgctgctggttatcaagcaacaaaagctggt
attccaagcgctacaatatcaatcccaacaaggtatatacatacaccaagcgaaatggtg
tttgaaccagatgtggaagcctctatacaattgactatgaaatattgtgaagaggggctt
gaataa

DBGET integrated database retrieval system