KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0021Help
Entry
FN0021            CDS       T00077                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.-)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FN0021
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     FN0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660030..660914
Genome map
AA seq 294 aa AA seqDB search
MRISLNKYKIFSNAKINIGLNVFQKESDGYHNIDSIMAPIDLSDEMDVTFYSDLGDLKIE
CSDKSIPTDERNILYKTYKIFFEESKKEKEKIDIILKKNIPSEAGLGGGSSNAGFFLKLL
NKHYGNVYNEKELEKLAMRVGSDVPFFIKNKTARVGGKGNRVDLVENNLKDSIILIKPLD
FGVSTKEAYESFDNLKEVKYADFDKIIKNLKEGNRIALESNIENSLEQGILETDTNIKML
KMTLNSVVSGKKFFMSGSGSTYYTFVTELEKSQIETRLKTFVDNVKIIICKTIN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttctttgaataagtataagatattttcaaatgctaaaattaatataggttta
aatgtttttcaaaaagagagtgatggctatcataatattgattctataatggctcctatt
gatttatctgatgaaatggatgtaacattttattcagacttaggagatttaaaaattgaa
tgttctgataagagtattcctactgatgaaagaaatattttgtataaaacatataaaata
ttttttgaagaaagtaaaaaagaaaaggaaaaaattgatattatcttaaaaaaaaatata
ccatctgaagctggcttaggtggaggaagttctaatgcaggctttttcttgaaactttta
aataaacattatggaaatgtctataatgaaaaggaattagaaaaactagcaatgagagtt
ggaagtgatgttccattctttattaaaaataagacagctagggttggtggaaaaggaaat
agagtagacttagtagaaaataaccttaaagattcaataattttgataaaaccattagat
tttggtgtatccacaaaagaagcctatgagagttttgataacttaaaagaagttaaatat
gctgattttgataagattattaagaatctaaaagaaggtaatagaattgctttggaaagt
aatatagagaacagtttagaacaaggaattttagaaacagatacaaatataaaaatgttg
aaaatgacattaaattcagttgtatctgggaaaaaattttttatgtcagggagtgggagt
acatactacacatttgttacagaacttgagaaatcccaaattgaaacaagattaaaaact
tttgttgataatgtaaagattattatatgtaaaacaataaactaa

DBGET integrated database retrieval system