KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0021Help
Entry
FN0021            CDS       T00077                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.-)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:fnu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660030..660914
Genome map
AA seq 294 aa AA seqDB search
MRISLNKYKIFSNAKINIGLNVFQKESDGYHNIDSIMAPIDLSDEMDVTFYSDLGDLKIE
CSDKSIPTDERNILYKTYKIFFEESKKEKEKIDIILKKNIPSEAGLGGGSSNAGFFLKLL
NKHYGNVYNEKELEKLAMRVGSDVPFFIKNKTARVGGKGNRVDLVENNLKDSIILIKPLD
FGVSTKEAYESFDNLKEVKYADFDKIIKNLKEGNRIALESNIENSLEQGILETDTNIKML
KMTLNSVVSGKKFFMSGSGSTYYTFVTELEKSQIETRLKTFVDNVKIIICKTIN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttctttgaataagtataagatattttcaaatgctaaaattaatataggttta
aatgtttttcaaaaagagagtgatggctatcataatattgattctataatggctcctatt
gatttatctgatgaaatggatgtaacattttattcagacttaggagatttaaaaattgaa
tgttctgataagagtattcctactgatgaaagaaatattttgtataaaacatataaaata
ttttttgaagaaagtaaaaaagaaaaggaaaaaattgatattatcttaaaaaaaaatata
ccatctgaagctggcttaggtggaggaagttctaatgcaggctttttcttgaaactttta
aataaacattatggaaatgtctataatgaaaaggaattagaaaaactagcaatgagagtt
ggaagtgatgttccattctttattaaaaataagacagctagggttggtggaaaaggaaat
agagtagacttagtagaaaataaccttaaagattcaataattttgataaaaccattagat
tttggtgtatccacaaaagaagcctatgagagttttgataacttaaaagaagttaaatat
gctgattttgataagattattaagaatctaaaagaaggtaatagaattgctttggaaagt
aatatagagaacagtttagaacaaggaattttagaaacagatacaaatataaaaatgttg
aaaatgacattaaattcagttgtatctgggaaaaaattttttatgtcagggagtgggagt
acatactacacatttgttacagaacttgagaaatcccaaattgaaacaagattaaaaact
tttgttgataatgtaaagattattatatgtaaaacaataaactaa

DBGET integrated database retrieval system