KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0072Help
Entry
FN0072            CDS       T00077                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fnu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711855..712679
Genome map
AA seq 274 aa AA seqDB search
MDKIYIRDLEFIGYHGLFEEEKKLGQKFFVSLELTTNLREAGLNDDITKTTHYGEVSETV
KKIFFQKKYDLIETLAEDIAREVLLNYPLISELKLEIKKPWAPVGIALKDVSVEITRKWN
EVYISLGTNMGKKKKNMEKAIKEVANIKDTFIIKESTIIETEPFGYKEQDDFLNSCIGVK
TLLAPREILKELLSIEKKMGRERKIKWGPRIIDLDIIFYGKEVIEEDDLVVPHPYMEYRE
FVLKPLEEIIPNFVHPLLSKRISTLRKELENEKN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatttatataagagatttagaatttataggttatcatggactttttgaagaa
gaaaaaaaattaggtcaaaaattctttgtaagtttagagcttactactaatttaagggaa
gcaggattaaatgatgatataacaaaaacaactcattatggagaagtttcagaaactgta
aaaaaaatcttttttcaaaagaaatatgatttaatagaaactttggcagaagatatagca
agggaagtattgcttaattatcctttaataagtgagttaaaattagaaataaaaaaacct
tgggcaccagtgggaatagctcttaaagatgtttctgtggaaattacaagaaaatggaat
gaagtatatatctcattgggaactaatatgggaaaaaagaaaaagaacatggaaaaagcc
ataaaagaagtagctaatataaaagatactttcattataaaagaaagtacaattattgaa
acggagccttttggttataaagaacaagatgactttttaaattcttgtataggtgtaaaa
actctattagcaccaagagaaattttaaaagaattgctttccatagaaaagaagatggga
agagaaagaaaaattaaatggggacctagaatcattgatttagatataattttctatggc
aaggaagttatagaagaagatgatttagtagtacctcatccatatatggagtacagagag
tttgtcctaaaacctttggaagaaataatacctaattttgttcatcctttgctttcaaag
agaattagtactctaagaaaggagcttgaaaatgaaaaaaattag

DBGET integrated database retrieval system