KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0072Help
Entry
FN0072            CDS       T00077                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FN0072
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     FN0072
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     FN0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711855..712679
Genome map
AA seq 274 aa AA seqDB search
MDKIYIRDLEFIGYHGLFEEEKKLGQKFFVSLELTTNLREAGLNDDITKTTHYGEVSETV
KKIFFQKKYDLIETLAEDIAREVLLNYPLISELKLEIKKPWAPVGIALKDVSVEITRKWN
EVYISLGTNMGKKKKNMEKAIKEVANIKDTFIIKESTIIETEPFGYKEQDDFLNSCIGVK
TLLAPREILKELLSIEKKMGRERKIKWGPRIIDLDIIFYGKEVIEEDDLVVPHPYMEYRE
FVLKPLEEIIPNFVHPLLSKRISTLRKELENEKN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatttatataagagatttagaatttataggttatcatggactttttgaagaa
gaaaaaaaattaggtcaaaaattctttgtaagtttagagcttactactaatttaagggaa
gcaggattaaatgatgatataacaaaaacaactcattatggagaagtttcagaaactgta
aaaaaaatcttttttcaaaagaaatatgatttaatagaaactttggcagaagatatagca
agggaagtattgcttaattatcctttaataagtgagttaaaattagaaataaaaaaacct
tgggcaccagtgggaatagctcttaaagatgtttctgtggaaattacaagaaaatggaat
gaagtatatatctcattgggaactaatatgggaaaaaagaaaaagaacatggaaaaagcc
ataaaagaagtagctaatataaaagatactttcattataaaagaaagtacaattattgaa
acggagccttttggttataaagaacaagatgactttttaaattcttgtataggtgtaaaa
actctattagcaccaagagaaattttaaaagaattgctttccatagaaaagaagatggga
agagaaagaaaaattaaatggggacctagaatcattgatttagatataattttctatggc
aaggaagttatagaagaagatgatttagtagtacctcatccatatatggagtacagagag
tttgtcctaaaacctttggaagaaataatacctaattttgttcatcctttgctttcaaag
agaattagtactctaagaaaggagcttgaaaatgaaaaaaattag

DBGET integrated database retrieval system