KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0073Help
Entry
FN0073            CDS       T00077                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FN0073
Enzymes [BR:fnu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FN0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712660..713493
Genome map
AA seq 277 aa AA seqDB search
MKMKKISCGNKEIILGERTLVMGILNVTPDSFSDGGKYNNLDSAIKQAEKLILDGADIID
VGGESTRPGHVQITSEEEISRVVPIIEKISKNLNTIISIDTYKYDVAEEAIKAGANIIND
IWGLQYDNGEMAELVKKSKLPIIAMHNQNDEIYSKDIMLSLREFFEKTYKIADKYGIDRD
KIILDPGLGFGKNVEQNIEVLSRLNELKDMGSILLGASKKRFIGKLLNDLPFDERVEGTV
ATTVIGIEKGVDIVRVHNVLENKRACLVADGIYRKRG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatgaaaaaaattagttgtggaaataaagaaattattttaggagaaagaacttta
gtaatgggaattttaaatgttacccctgattctttttcagatggtggaaaatataataat
ttagattctgcaattaaacaagcagaaaagctaatcttagatggagcagacataatagat
gtaggtggggaatccacaagaccaggacatgttcaaataacatcagaagaagaaatatca
agagtagtgccaattatagaaaagatttctaaaaatttaaatacgataatttctatcgat
acatataaatatgatgtagcagaagaagcaataaaagctggtgcaaatataataaatgat
atttggggcttacaatatgacaatggagaaatggcagagttagtaaaaaaatctaaactt
ccaattattgcaatgcacaatcaaaatgatgaaatttacagtaaagatataatgttatct
ttgagagaattttttgaaaaaacatataagatagcggataaatatggaattgatagagat
aaaataattttagacccaggtttaggttttggaaagaatgttgagcaaaatatagaagtt
ttatcaagattaaatgaattaaaagatatgggatctattttattaggtgcttctaaaaaa
agatttataggaaaacttcttaatgatttaccttttgatgaaagagttgaaggaactgtt
gcaactactgtgataggtatagaaaaaggagtggatatagtaagagtccataatgtttta
gaaaataaaagagcttgtctagttgcagatggtatatatagaaagagagggtaa

DBGET integrated database retrieval system