KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0245Help
Entry
FN0245            CDS       T00077                                 

Definition
copper-exporting ATPase (EC:3.6.3.4)
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Brite
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     FN0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
868431..870740
Genome map
AA seq 769 aa AA seqDB search
MENNINLKTEIGNNQENENQKLELKIDGISCQACVAKIERKLSKTNGVGKALVNISNNMA
DIEYNEKEIKASEIMKIIEKLGYTPKRREDLKDKEEALRAEKKLKLELTKSKIVIVLSFI
LMYISMSHMFGLPLPNILNPEMNIVNYVLTQLILAITVMIIGKRFYKVGFRQLYMLSPNM
DSLVAVGTSSAFIYSLYISYKIFAGNNIHLIHSLYYESAAMIIAFVMLGKYLETLSKGKA
SAAIKKLVNFQAKKASIIRNGEIIEIDIEEVSKGDTVFIKPGEKIPVDGVIIEGHSTIDE
AMITGESIPVEKTENDKVYSGSINKDGALKVTVNATEGETLISKIAKLVEDAQMTKAPIA
RLADKVSLIFVPTVIFIAVFAALLWWFLIKYNVISVSQNQFEFVLTIFISILIIACPCSL
GLATPTAIMVGTGKGAELGILIKSGEALEKLNQIDTIVFDKTGTLTEGMPKVIDIVSLGN
IDKDEILKISASMEVSSEHPLGKAIYDEAKEKNINLYDVKNFLAISGRGVIGEIEAKKYL
LGNKKLLLDNNIKDLYEEEIHKYELQGKTTIFLADEEKLIAFITLADVVRNESLELIKKL
KKENIKTYILTGDNERTARVIAEKLGIDDVIAEVSPEDKYKKVKELQEQGKKVAMVGDGI
NDSPALAQADVGIAIGSGTDIAIESADIVLMGKDIKIILTAIRLSRATIKNIKENLFWAF
FYNTCGIPIAGGLLYLFTGHLLNPMIAGLAMGMSSVSVVSNALRLKRFK
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggagaataatataaatttaaaaacagaaattggcaacaatcaggaaaatgaaaatcaa
aaattagaactaaaaattgatggtataagttgtcaagcttgtgttgcaaagattgaaaga
aaattatcaaagactaatggagtaggaaaagcacttgttaatatttcaaataatatggca
gatattgaatataatgaaaaagaaataaaagctagtgaaattatgaaaataattgaaaag
ctaggttatactccaaaaagaagagaagatttaaaagataaagaagaagctcttagagca
gaaaaaaaactaaaattagaattaactaaatcaaaaattgttatagttctatcttttata
cttatgtatatttcaatgagccatatgtttggattgccgcttccaaatatacttaatcca
gaaatgaatattgtaaattatgtgctaacacaattaattttagctataactgttatgata
attggaaaaagattttataaggttggttttagacagttatatatgttaagtcctaatatg
gatagcttagtagcagtgggaacaagttcagcatttatatatagtttatatataagctat
aaaatatttgcaggtaataatatccatttgatacattcactatattatgaatcagctgca
atgataatagcctttgtaatgctaggaaaatacttagaaactttaagcaaaggtaaagct
tcagctgcaataaagaaattggtaaattttcaagctaaaaaagctagtattataagaaat
ggcgaaataattgaaatagatatagaagaagtatcaaaaggagatacagtttttataaag
cctggtgaaaaaattccagttgatggtgtaataatagagggacattcaactattgatgaa
gctatgattacaggagaaagtatcccagttgaaaaaactgaaaatgataaggtatatagt
ggaagcataaataaagatggagcattgaaagttactgtaaatgcaacagaaggagaaact
ctaatatcaaaaatagccaaacttgttgaagatgcacagatgacaaaagcaccaatagca
aggcttgcagataaagtttctttaatatttgttccaacagttatttttattgctgttttt
gcagctttactttggtggtttttaataaaatacaatgtgatatcagtaagtcaaaatcaa
tttgagtttgtattgactatttttatatctatacttataattgcctgtccttgttcattg
ggacttgccacaccaacagctataatggttggaacaggtaagggagcagagttaggtatc
ttaataaaatctggtgaagcattagaaaaattaaatcaaattgacactattgtttttgac
aaaacaggtactttaacagaaggtatgccaaaagttatagatatagtaagtttaggtaat
atagataaagatgaaatattaaaaatatctgcttctatggaagtaagttcagaacaccca
ctaggaaaagcaatctatgatgaagcaaaagaaaagaatattaacttatatgatgtaaaa
aatttcttagctatttcaggtaggggagtaattggagaaattgaagctaaaaaatattta
ttgggaaataaaaaattacttcttgataataatataaaagatttatatgaagaagaaata
cataaatatgaattacaagggaaaacaaccatttttttagctgatgaagaaaagttaatt
gcttttataacattggcagatgttgttagaaatgaaagtcttgaacttataaagaaatta
aaaaaagaaaatataaaaacatatatacttacaggtgataatgaaagaactgcaagagta
atagcagaaaaattaggaatagatgatgttattgcagaagtgtcccctgaagataaatat
aaaaaggttaaggaattacaagaacaaggtaagaaagttgcaatggttggggatggaata
aatgattctcctgcacttgcacaagcagatgttggaatagcaataggaagtgggacagat
attgcaatagaaagtgctgatatagttcttatgggaaaagatataaaaattattcttact
gctataagattgagtagagcaactataaaaaatattaaagaaaatctattctgggcattt
ttctataacacttgtggcattccaatagctggaggtttactatatttattcacaggacat
ttactaaatcctatgatagcagggcttgctatgggaatgagttctgtatcagttgtaagt
aatgctttgagattaaagagatttaagtaa

DBGET integrated database retrieval system