KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0278Help
Entry
FN0278            CDS       T00077                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FN0278
  Amino acid metabolism
   00300 Lysine biosynthesis
    FN0278
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     FN0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(904396..905754)
Genome map
AA seq 452 aa AA seqDB search
MDLKEKILDYKDEVVKEIQNAVRVKSVKEAPLPGMPFGEGPAKALDHFMDLAKKLGFKAE
KFDNYAMHIDMGEGKETLGILAHVDVVPEGDNWTYPPYSGTIADGKIFGRGTLDDKGPAI
ISLFAMKAIADSGVKLNKKIRMILGADEESGSACLKYYFGELKMPYPDIAFTPDSSFPVT
YAEKGSVRVKIKKKFNTLQDLVIKGGNAFNSVPNEANGVIPVDMLGEVRNKNKVEFEREG
NTYKVFSAGIPAHGAYPSKGYNAVSALFEVLKDIEVKNEELKGLVTFFDKFVKMETDGKS
FGVKCTDGETGELTLNLGKINLENNELEIWIDMRIPVKVKNEQIIETIKENTEDYGYEFL
LHSNTQPLYVAKDSFLVSTLMNIYKELTGDNDAEPVAIGGGTYAKYAKNAVAFGALLPDQ
EDRMHQRDEYLEISKIDKLLQIYVEAIYRLAK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaagaaaaaattttagattacaaagatgaggttgtaaaagaaattcagaat
gcagttagagtaaaaagtgttaaagaagcaccattacctggaatgccttttggagaagga
ccagcaaaagcacttgatcattttatggacctagctaaaaaattaggatttaaagcagaa
aaatttgataattatgcaatgcatatagatatgggagaagggaaagaaacattaggaata
cttgctcatgttgatgtagttccagaaggtgacaactggacttatcctccttattcagga
acaatagcagacggaaaaatctttggtagagggacattagatgataaaggacctgctata
atttcattatttgctatgaaagcaatagcagattcaggggtaaaattaaataaaaaaatt
agaatgatattaggagcggatgaagaaagcggaagtgcttgtttaaaatattattttgga
gaattaaaaatgccttatcctgatattgcatttacaccagattcaagtttccctgtaact
tatgcagaaaaaggtagtgtaagagttaaaataaagaaaaaatttaatactttacaagat
ttagtaataaaaggtggaaatgcttttaactctgttccaaatgaagctaatggagtaatt
cctgttgatatgcttggggaagttagaaacaaaaataaagttgaatttgaaagagaagga
aatacatataaagtattttcagcaggtatcccagcacatggagcatatccaagcaaagga
tacaatgcagtatcagcattatttgaagttttaaaagatattgaagttaaaaatgaagaa
ttaaaaggtttagttacattctttgataaatttgtaaagatggaaactgatggtaaatct
tttggagttaaatgtacagatggagaaacaggggaattaactttaaatttaggaaaaata
aatttagaaaataatgaacttgaaatctggatagatatgagaattcctgttaaagttaaa
aatgaacaaataatagaaactattaaggaaaatactgaagactatggatatgaattttta
ttacattcaaatactcaacctttatatgttgcaaaagatagtttcttggtttcaacttta
atgaatatctataaagaattgacaggagataatgatgcagagccagtagcaataggtgga
ggaacttatgctaaatatgcaaaaaatgctgttgcattcggagctttacttccagatcaa
gaagacagaatgcaccaaagagatgagtatttagaaatatcaaagatagataaacttctt
caaatatatgttgaagcaatttatagattagcaaaatag

DBGET integrated database retrieval system