KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0317Help
Entry
FN0317            CDS       T00077                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FN0317
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0317
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FN0317
Enzymes [BR:fnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FN0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(953909..955096)
Genome map
AA seq 395 aa AA seqDB search
MTTENKKGYFGEFGGSYVPEVVQKALDKLEEAYNKYKDDEEFLKEYHHYLKNYSGRETPL
YFAESLTNYLGGAKIYLKREDLNHLGAHKLNNVIGQILLAKRMGKKKVIAETGAGQHGVA
TAAAAAKFGMQCDIYMGALDVERQRLNVFRMEILGATVHAVEKGERTLKEAVDAAFKAWI
NNINDTFYVLGSAVGPHPYPSMVKDFQRVISQEARRQILEKENRLPDMIIACVGGGSNAI
GAFAEFIPDKEVKLIGVEAAGKGLNTDRHAATLTLGTVDVLDGMKTYALFNEDGSVKPVY
SISPGLDYPGIGPEHAFLRDSKRAEYVSATDDEAVNALLLLTKKEGIIPAIESSHALAEV
IKRAPKLNKNKIIIVNISGRGDKDVAAIAEYLKNK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaaaacaaaaaaggttattttggcgaatttggtggaagttatgttccagaa
gtagtacaaaaagcattagataaattagaagaggcatacaataaatataaagatgatgaa
gaatttttaaaagaatatcatcattatttaaaaaattattcaggcagagaaactccttta
tactttgcagaaagtctaacaaattatttaggtggagcaaaaatttatttaaaacgtgaa
gatttaaatcatttaggtgctcataaattaaataatgttataggacaaattttacttgcc
aaaagaatgggtaagaaaaaagttattgctgaaacaggtgcaggacagcatggtgttgct
actgctgcagctgctgcaaaatttggaatgcaatgtgatatttatatgggagcattagat
gtagaaagacaaagattaaatgtttttcgtatggaaatattaggagcaactgttcatgct
gttgaaaaaggagagagaacattaaaagaagctgttgatgctgcatttaaagcttggata
aataatataaatgacactttctatgtacttggttctgctgttggtcctcatccttatcca
agtatggtaaaagatttccaaagagttatcagccaagaagctcgtagacaaattttagaa
aaagaaaatcgtttacctgatatgataattgcttgtgtaggcggaggttctaatgctatt
ggtgcatttgcagaatttattcctgataaagaagtaaaattaattggagttgaagctgca
ggtaaagggttaaatacagatagacatgctgcaactcttacattgggaacagtagatgtt
ttagacggaatgaaaacttatgctctattcaacgaagatggttctgtaaaaccagtttat
tcaatatctcctggtttagattatccaggaattggtccagaacatgcttttttaagagat
agtaaaagggcagaatatgtatctgcaactgatgatgaagcagttaatgcacttttatta
ctaactaaaaaagaaggaattatccctgctattgaaagttctcatgctttggcagaagtt
attaaaagagctcctaaactaaataaaaataaaattattattgtaaatatttctggtcgt
ggagataaagatgttgcagctattgctgaatatttaaagaataaataa

DBGET integrated database retrieval system