KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0412Help
Entry
FN0412            CDS       T00077                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fnu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1048689..1049282
Genome map
AA seq 197 aa AA seqDB search
MPTKSLERLILEFNKLPGVGQKSATRYAFHILNQSEEDVKNFAEALLAVKENVKKCHVCG
NYCESDTCNICSDNARDHRIICVVEESKDIMILEKTTKFRGVYHVLNGRLDPLNGITPNE
LNIKSLLERIAKDDIEEIILATNPNIEGETTAMYLAKLMKNFGIKITKLASGIPMGGNLE
FSDTATISRALDDRIEI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccaactaaaagtttagaaagattgatattagaatttaataaattaccaggagtaggg
caaaagtcagcaacaagatatgcttttcatattttaaatcaatctgaggaagatgttaaa
aattttgctgaggcacttttagcagttaaagaaaatgtaaaaaaatgtcatgtatgtggt
aattactgtgaaagcgatacttgtaatatttgttctgataatgctagggatcatagaata
atttgtgttgttgaagaaagtaaagatattatgattttagaaaaaacaactaaatttagg
ggagtttatcatgttttaaatggtagacttgatcctttaaatggtattactccaaatgaa
cttaatataaagtctttacttgaaagaatagcaaaagatgatatagaagaaataatttta
gcaactaaccctaatattgagggagaaactactgctatgtatcttgctaaacttatgaaa
aattttggaataaaaattactaaattagcaagtggaatacctatgggaggaaatttagag
ttttcagacactgcaactatttctcgtgccttagatgatagaattgaaatttaa

DBGET integrated database retrieval system