KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0417Help
Entry
FN0417            CDS       T00077                                 

Definition
type III restriction-modification system restriction subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Brite
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     FN0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056027..1059020
Genome map
AA seq 997 aa AA seqDB search
MKIKFEENLEYQLEAINSITDIFSGQETAKTVFTVEKSNNPQLSIIADENDLGTGNKLLL
LPEEISENLNNIQTRNGLAKTEVLGKNTYNFSIEMETGTGKTYVYLRTIMELNKKYGFTK
FIIVVPSLAIKEGVYKTLQITEEHFKSLYENTPYDYFIYDSKKINMIRNFAVNDNIQILI
INIDSFNKDTNIINQERDQANGYRPIDYISQCNPIVIVDEPQNMESDIAKKAIKELNPLC
TLRYSATHKERYNPVFKLDSIAAYEKKLVKQIEVATVGVAQNLNTEYIKVVSIKATKTGI
TAKIELDVKNKSGVSRKEISIKHGDILSEKAKRDIYDGYIVNEITYNEVDPAKSFIDFGK
VRLTLGQVNGGQDPDLIKRLQIRKTIQEHFEKQLALRSKGIKVLSLFFIDKVANYRIYDS
ETGEAKKGKYALMFEEEYNNFIQSGKYQGVGDVSKVHDGYFSVDKKKTKSGIEYFEDKDT
KGNTNADNDTFTKIMKDKEKLLSFNEPLAFIFSHSALKEGWDNPNVFQICTLNETSSEIK
KRQEIGRGLRIAVNQEGERVRGFDVNTLTVMANESYEHFVESLQKEMEKEENIKFGLIED
FIFANIVIDYENGKEVFLGHEKSKEIFQDLIKRDYIDKSGNAKDKLKKDLDEGNLELAEE
FKNIKEIIIKKLKSTTGKLVIKNADERKKITLNKEVFLSDEFKELWDKVKYKTTYQVNFN
GEELIDKCIKNLDEGVYIPAEKFLYDKKRLAITKGGIEEAGAYELEENIEVSNSYKLPDI
ITYLQNETNLTRKSIVKILTKSKTLNSFKKNPQLYLEQASDIIKRTMRLFIVDGIKYEKI
GDVEYYSQELFENNEIFGYLKDEMSRQGNMVKTEKTPYSSIIIDSEIERKFAEGLENNGN
IKVYTKLPDWFKIPTPLGNYNPDWAILVEEPNQNKEKLYFVVETKGTTFEEGRRDLENLK
IDCGRKHFEALKVDYSDCDSISNFKIYIEKIKEKNKN
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaatttgaagagaatttagaatatcagttggaagcaataaactctataact
gatatattttcaggacaagaaacagctaagactgtattcacagtagaaaaaagcaataat
cctcaattaagtataatagctgatgaaaatgatttaggaactgggaataaacttttatta
cttccagaagaaatttcagaaaatttaaataatattcaaactagaaatggtttagctaaa
acagaagtattaggaaaaaatacatataatttttctattgaaatggaaacaggaacagga
aaaacttatgtatatttaagaactataatggaactaaataaaaaatatggatttacaaaa
tttattatagttgttccttcattagcaataaaagagggagtatataaaacacttcaaatt
acagaagaacattttaaaagtctgtatgaaaatactccttatgattattttatttatgat
tctaaaaaaataaatatgataagaaattttgctgtaaatgataatatccaaattttgatt
attaatatagactcatttaataaagatacaaatattattaatcaagaaagagatcaagct
aatggttatagaccgatagattatattagtcaatgcaatccaatagtaatagttgatgaa
ccacaaaatatggaaagcgatatagcgaagaaagcaataaaagagctaaatcctctatgt
acattaagatattcagcaacacataaagaaagatataatccagtatttaaactagactca
atagctgcttatgagaaaaaattagtaaaacaaatagaagtagcaacagtaggagttgca
caaaatttaaatactgaatatataaaagttgtcagtataaaagctactaagactggtatt
acagctaaaatagaacttgatgtaaaaaataagtcaggtgtgagtagaaaagaaattagt
ataaaacatggggatattttaagtgaaaaggcaaaaagagatatttatgatggctatata
gtaaatgaaatcacatataatgaagttgacccagctaagtcttttatagattttgggaaa
gtgagattaactttggggcaagtaaatggaggacaagacccagatttaataaaaagattg
caaattagaaaaacaattcaagaacattttgaaaaacaattagctttaagaagtaaaggg
ataaaagttttatcacttttcttcatagataaagttgcaaattatagaatatatgattca
gaaactggggaagctaaaaaaggaaagtatgctttaatgtttgaagaagaatataataac
tttatacaatcaggaaaatatcaaggagtaggagatgtttctaaggtacatgatggatat
ttttcagtagataaaaagaaaactaaaagtggcatagagtattttgaagataaagataca
aaaggtaatacaaatgctgataatgatacttttactaagataatgaaagataaggaaaaa
cttttaagttttaatgaacctttggcatttattttttcacattcggctttaaaagaaggt
tgggataatccaaatgtatttcaaatttgtactttgaatgaaacaagttctgaaataaag
aaaagacaggaaatagggagaggacttagaattgcagtaaaccaagagggagaaagagtt
agaggttttgatgtaaatacattaacagtaatggcaaatgaatcttatgaacattttgta
gaatctttacaaaaagaaatggaaaaagaagaaaatattaaatttggacttatagaagat
tttatttttgcaaatattgtgattgattatgaaaatggaaaagaagtttttcttggacat
gaaaaatcaaaagagatatttcaagatttaataaagagagattatattgataaatctgga
aatgctaaggataaattaaaaaaagatttagatgaaggaaacttagaattagcagaagaa
tttaaaaatataaaagaaatcattattaagaaattaaaatctactactggaaaattagtt
attaaaaatgctgatgaaagaaaaaaaataactttaaataaagaagtatttttgagtgat
gagtttaaagaattgtgggataaggtaaagtataaaacaacatatcaagtaaattttaac
ggagaagaattaatagataaatgtataaaaaatttagatgaaggagtatatattccagct
gaaaaatttttatatgataaaaaaagactggctattacaaaaggtggaatagaggaagct
ggagcttatgaattggaagaaaatatagaagtctctaatagttataaattacctgatata
attacttatttacaaaatgaaacaaatcttacaagaaagagtatagtaaaaattttaact
aaatctaaaactttaaatagttttaagaaaaatcctcagttatatttagaacaagctagt
gatataattaaaagaacaatgagattatttatagtagatggtattaaatatgaaaaaata
ggagatgtagaatactattcccaagaattatttgaaaataatgaaatttttggatatctt
aaagatgaaatgagtagacaaggaaacatggtaaaaacagaaaaaacaccgtatagtagt
attattattgactctgagatagaaagaaagtttgcagaaggattagaaaataatggaaat
attaaagtttatacaaaacttccagattggtttaaaataccaactccattaggaaactat
aatccagattgggcaatactggtggaagaaccaaatcaaaataaagaaaaattatatttt
gttgtggaaacaaaggggacaacttttgaggaaggaagaagagatttagagaatttaaaa
attgattgtggaagaaaacattttgaagcattaaaagttgattattcagattgtgacagt
ataagcaattttaaaatctatattgaaaaaataaaagaaaaaaataaaaattga

DBGET integrated database retrieval system