KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0460Help
Entry
FN0460            CDS       T00077                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FN0460
Enzymes [BR:fnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FN0460
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FN0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1105622..1106590
Genome map
AA seq 322 aa AA seqDB search
MFIRTRRLRKNFLTRELVKNISIEKSSLIYPLFVCDGENIKSEIESMPQQFRYSLDRLNE
ELDDLLKLGINNILLFGIPNHKDELGSQAYDENGIVQRTVRQIRRDYQDKFLIVTDVCMC
EYTSHGHCGILHNHDVDNDETLEYIAKIASSHAKAGADIIAPSDMMDGRIGKIREVLDKN
NFKDIPIMSYSVKYSSAYYGPFRDAADSAPSFGDRKTYQMDFRSYNNFYREVEADTQEGA
DFIMVKPAMAYLDVIKSVSKISNLPIVAYNVSGEYSMVKAAAKNNWIDEQKIVMENMYAI
KRAGADIIITYHAKDIAKWLSN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttataagaacaagaagattaagaaaaaattttttaacaagagaattagttaaaaat
attagtattgaaaagagttcattgatatatccattatttgtatgtgatggagaaaatata
aaatctgaaatagaatctatgccacaacaatttagatattctttggatagattgaatgaa
gaattagatgacttattaaaattaggaattaataatattttactttttggaatacctaat
cataaagatgaattaggaagtcaggcttatgatgaaaacggaattgttcaaaggacagta
agacaaatcagaagagattatcaagataaatttttaatagttactgatgtatgtatgtgt
gaatacacttctcatgggcattgtgggattttacataatcatgatgtagataatgatgaa
acacttgaatatatagctaaaattgcctcatctcatgcaaaagcaggagcagatataata
gcaccatctgatatgatggatggaaggattggaaaaattagagaggttttagataagaat
aattttaaagatattccaataatgtcatacagtgtaaaatattcatctgcatattatgga
ccttttagagatgccgctgattcagcaccaagttttggagatagaaaaacttatcaaatg
gattttagaagttacaataatttttatagagaagttgaggctgacacacaagagggagca
gattttataatggtaaaacctgctatggcttatttagatgttataaaatcagtttcaaaa
attagtaatttaccaattgttgcctataatgtaagtggagaatattctatggttaaagca
gcagcaaaaaacaactggatagatgaacaaaaaatcgttatggaaaatatgtatgcaata
aaaagagctggagctgatataataatcacttatcatgcaaaggatatcgcaaaatggttg
tctaattaa

DBGET integrated database retrieval system