KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0501Help
Entry
FN0501            CDS       T00077                                 

Definition
(RefSeq) arginase
  KO
K01585  
arginine decarboxylase [EC:4.1.1.19]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FN0501
Enzymes [BR:fnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     FN0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1149677..1152028)
Genome map
AA seq 783 aa AA seqDB search
MSKLDQNKTPLFTVLKDEYVRRNILPFHVPGHKRGKGVDEEFYNFMGEAPFSIDVTIFKM
VDGLHHPKSCIKESQELVADAYGVKHSFFAVNGTSGAIQAMIMSVVKAGEKILVPRNVHK
SVSAGIILSGSEPVYMNPEIDENLGIALGVKPQTVENMLKQDPDIAAVLIINPTYYGVAT
DIKKIADIVHSYDIPLIVDEAHGPHLHFHDELPVSAVDAGADICTQSTHKILGAMTQMSL
IHVNSDRVNVEKVKQILSLLHTTSPSYPLMASLDCARRQIATQGQELLTRTIELAKYFRR
EANRIPGIYCFGEELVGKDGFFAFDPTKITISAKELGLKGGELESLLVDDYNIQMELSDY
YNTLGLITIGDTEESVNKLLDALRDISRRFFGKGKTLEKNIIKLPETPELVLMPREAFYS
EKNKVPFKESVGKISGEMIMAYPPGIPIIIAGERISQDIIDHIEELKEADLHIQGMEDPE
LETINVIEEEDAIYLYTEKMKNVLIGVQTNLGVNKTGTEFGPDDLIQAYPDTFDEMELIS
VERQKEDFNDKKLKFKNTVLDTCEKIAKRVNEAVIDGYRPILVGGDHSISLGSVSGVSLE
KEIGVLWISAHGDMNTPESTLTGNIHGMPLALLQGLGDRELVNCFYEGAKLDSRNIVIFG
AREIEVEERKIIEKTGVKIVYYDDILRKGIDNVLDEVKDYLKIDNLHISIDMNVFDPEIA
PGVSVPVRRGMSYDEMFKSLKFAFKNYSVTSADITEFNPLNDINGKTAELVNGIVQYMMN
PDY
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattagaccaaaataagacaccattatttacagtattaaaagatgaatatgtg
agaagaaatatacttccatttcatgttcctggacataaaagaggaaaaggagttgatgaa
gaattttataacttcatgggagaggctcctttttcaatagatgtaacaatttttaaaatg
gttgatggtcttcatcatccaaaaagttgtattaaagaatctcaagaattagttgcagat
gcttatggggttaaacatagtttctttgcagtaaatggaacttctggtgctatacaagca
atgataatgtcagttgtaaaagcaggggaaaaaatattagtaccaagaaatgttcataaa
tcagtttcagcaggaattattttaagtggttctgaacctgtgtatatgaatcctgaaatt
gatgaaaatttaggaattgctttaggtgttaaaccacaaacagttgaaaatatgttaaaa
caagatccagacatagcagctgttcttattataaatccaacttattatggggtagcaaca
gatattaaaaagatagcagacatagttcatagctatgatatacctcttattgtagatgaa
gctcatggaccacatttacactttcatgatgaattaccagtttcagctgttgatgctgga
gcagatatctgtactcaaagtacacataaaattttaggtgctatgactcaaatgtctctt
attcatgtaaattcagatagagttaatgttgaaaaagtaaaacaaattttaagtttactc
catacaacttctccatcatatccattgatggcatctcttgattgtgcaagaaggcaaata
gctacacaagggcaagaattgcttacaagaactattgagcttgctaaatattttagaaga
gaagctaatagaatacctggaatttattgttttggagaagaacttgttggaaaagatggt
ttctttgcttttgacccaacaaaaattacaatatctgcaaaagaactaggacttaagggt
ggagagcttgaaagcctacttgtagatgactacaatattcaaatggaattatcagactac
tataacactttagggcttattacaataggagatacagaagaaagtgtaaataaattgcta
gatgctttaagagatataagcagaagattttttggaaaaggaaaaacattagaaaaaaat
attataaaacttcctgaaactcctgaattagtattaatgccaagagaagctttttacagt
gaaaagaataaagttccatttaaagaaagtgttggaaaaatatctggtgaaatgataatg
gcatatccacctggtatcccaataattattgcaggagaaagaataagtcaagatataatt
gatcatattgaagaattaaaagaagctgatttacatattcaaggtatggaagacccagaa
cttgaaaccataaatgtaattgaagaagaagacgctatttacttatacactgaaaagatg
aaaaatgttcttattggagtgcaaacaaatcttggagttaataaaacaggaactgaattt
ggaccagatgatttaattcaagcttatccagatacttttgatgaaatggaattaatttct
gttgaaagacaaaaagaagacttcaatgataaaaaattaaaattcaaaaatacagtttta
gatacttgtgaaaagatagctaagagagttaatgaagctgtaattgatggatatagacca
atacttgttggaggagaccactcaatttcattaggaagtgtatcaggtgtttctctagaa
aaagaaattggagttttatggataagtgctcatggagatatgaatacccctgaaagtaca
cttacaggaaatattcatggaatgccattagctttacttcaaggtctaggagatagggaa
cttgtaaattgtttctatgaaggagctaaacttgacagcagaaatattgttatctttggt
gcaagagaaattgaagttgaagaaagaaaaattattgaaaaaactggtgtaaagattgtt
tattatgatgatattctaagaaaaggtatagataatgttttagacgaagtgaaagattat
ctaaaaattgataatttacatatcagtatagatatgaatgtatttgacccagaaattgct
cctggtgtatctgtacctgttagaagaggaatgtcttatgatgaaatgtttaaatcattg
aaatttgcatttaaaaattactcagttacatcagcagatattacagaatttaatccattg
aatgatattaacggaaaaactgctgaacttgtaaatggtatagtacaatatatgatgaac
ccagattattaa

DBGET integrated database retrieval system