KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0501Help
Entry
FN0501            CDS       T00077                                 

Definition
(RefSeq) arginase (EC:3.5.3.1 4.1.1.17)
  KO
K01476  
arginase [EC:3.5.3.1]
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FN0501
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FN0501
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FN0501
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     FN0501
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     FN0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1149677..1152028)
Genome map
AA seq 783 aa AA seqDB search
MSKLDQNKTPLFTVLKDEYVRRNILPFHVPGHKRGKGVDEEFYNFMGEAPFSIDVTIFKM
VDGLHHPKSCIKESQELVADAYGVKHSFFAVNGTSGAIQAMIMSVVKAGEKILVPRNVHK
SVSAGIILSGSEPVYMNPEIDENLGIALGVKPQTVENMLKQDPDIAAVLIINPTYYGVAT
DIKKIADIVHSYDIPLIVDEAHGPHLHFHDELPVSAVDAGADICTQSTHKILGAMTQMSL
IHVNSDRVNVEKVKQILSLLHTTSPSYPLMASLDCARRQIATQGQELLTRTIELAKYFRR
EANRIPGIYCFGEELVGKDGFFAFDPTKITISAKELGLKGGELESLLVDDYNIQMELSDY
YNTLGLITIGDTEESVNKLLDALRDISRRFFGKGKTLEKNIIKLPETPELVLMPREAFYS
EKNKVPFKESVGKISGEMIMAYPPGIPIIIAGERISQDIIDHIEELKEADLHIQGMEDPE
LETINVIEEEDAIYLYTEKMKNVLIGVQTNLGVNKTGTEFGPDDLIQAYPDTFDEMELIS
VERQKEDFNDKKLKFKNTVLDTCEKIAKRVNEAVIDGYRPILVGGDHSISLGSVSGVSLE
KEIGVLWISAHGDMNTPESTLTGNIHGMPLALLQGLGDRELVNCFYEGAKLDSRNIVIFG
AREIEVEERKIIEKTGVKIVYYDDILRKGIDNVLDEVKDYLKIDNLHISIDMNVFDPEIA
PGVSVPVRRGMSYDEMFKSLKFAFKNYSVTSADITEFNPLNDINGKTAELVNGIVQYMMN
PDY
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattagaccaaaataagacaccattatttacagtattaaaagatgaatatgtg
agaagaaatatacttccatttcatgttcctggacataaaagaggaaaaggagttgatgaa
gaattttataacttcatgggagaggctcctttttcaatagatgtaacaatttttaaaatg
gttgatggtcttcatcatccaaaaagttgtattaaagaatctcaagaattagttgcagat
gcttatggggttaaacatagtttctttgcagtaaatggaacttctggtgctatacaagca
atgataatgtcagttgtaaaagcaggggaaaaaatattagtaccaagaaatgttcataaa
tcagtttcagcaggaattattttaagtggttctgaacctgtgtatatgaatcctgaaatt
gatgaaaatttaggaattgctttaggtgttaaaccacaaacagttgaaaatatgttaaaa
caagatccagacatagcagctgttcttattataaatccaacttattatggggtagcaaca
gatattaaaaagatagcagacatagttcatagctatgatatacctcttattgtagatgaa
gctcatggaccacatttacactttcatgatgaattaccagtttcagctgttgatgctgga
gcagatatctgtactcaaagtacacataaaattttaggtgctatgactcaaatgtctctt
attcatgtaaattcagatagagttaatgttgaaaaagtaaaacaaattttaagtttactc
catacaacttctccatcatatccattgatggcatctcttgattgtgcaagaaggcaaata
gctacacaagggcaagaattgcttacaagaactattgagcttgctaaatattttagaaga
gaagctaatagaatacctggaatttattgttttggagaagaacttgttggaaaagatggt
ttctttgcttttgacccaacaaaaattacaatatctgcaaaagaactaggacttaagggt
ggagagcttgaaagcctacttgtagatgactacaatattcaaatggaattatcagactac
tataacactttagggcttattacaataggagatacagaagaaagtgtaaataaattgcta
gatgctttaagagatataagcagaagattttttggaaaaggaaaaacattagaaaaaaat
attataaaacttcctgaaactcctgaattagtattaatgccaagagaagctttttacagt
gaaaagaataaagttccatttaaagaaagtgttggaaaaatatctggtgaaatgataatg
gcatatccacctggtatcccaataattattgcaggagaaagaataagtcaagatataatt
gatcatattgaagaattaaaagaagctgatttacatattcaaggtatggaagacccagaa
cttgaaaccataaatgtaattgaagaagaagacgctatttacttatacactgaaaagatg
aaaaatgttcttattggagtgcaaacaaatcttggagttaataaaacaggaactgaattt
ggaccagatgatttaattcaagcttatccagatacttttgatgaaatggaattaatttct
gttgaaagacaaaaagaagacttcaatgataaaaaattaaaattcaaaaatacagtttta
gatacttgtgaaaagatagctaagagagttaatgaagctgtaattgatggatatagacca
atacttgttggaggagaccactcaatttcattaggaagtgtatcaggtgtttctctagaa
aaagaaattggagttttatggataagtgctcatggagatatgaatacccctgaaagtaca
cttacaggaaatattcatggaatgccattagctttacttcaaggtctaggagatagggaa
cttgtaaattgtttctatgaaggagctaaacttgacagcagaaatattgttatctttggt
gcaagagaaattgaagttgaagaaagaaaaattattgaaaaaactggtgtaaagattgtt
tattatgatgatattctaagaaaaggtatagataatgttttagacgaagtgaaagattat
ctaaaaattgataatttacatatcagtatagatatgaatgtatttgacccagaaattgct
cctggtgtatctgtacctgttagaagaggaatgtcttatgatgaaatgtttaaatcattg
aaatttgcatttaaaaattactcagttacatcagcagatattacagaatttaatccattg
aatgatattaacggaaaaactgctgaacttgtaaatggtatagtacaatatatgatgaac
ccagattattaa

DBGET integrated database retrieval system