KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0501Help
Entry
FN0501            CDS       T00077                                 

Definition
arginase (EC:3.5.3.1 4.1.1.17)
Orthology
K01476  
arginase [EC:3.5.3.1]
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fnu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fnu00330]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fnu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1149677..1152028)
Genome map
AA seq 783 aa AA seqDB search
MSKLDQNKTPLFTVLKDEYVRRNILPFHVPGHKRGKGVDEEFYNFMGEAPFSIDVTIFKM
VDGLHHPKSCIKESQELVADAYGVKHSFFAVNGTSGAIQAMIMSVVKAGEKILVPRNVHK
SVSAGIILSGSEPVYMNPEIDENLGIALGVKPQTVENMLKQDPDIAAVLIINPTYYGVAT
DIKKIADIVHSYDIPLIVDEAHGPHLHFHDELPVSAVDAGADICTQSTHKILGAMTQMSL
IHVNSDRVNVEKVKQILSLLHTTSPSYPLMASLDCARRQIATQGQELLTRTIELAKYFRR
EANRIPGIYCFGEELVGKDGFFAFDPTKITISAKELGLKGGELESLLVDDYNIQMELSDY
YNTLGLITIGDTEESVNKLLDALRDISRRFFGKGKTLEKNIIKLPETPELVLMPREAFYS
EKNKVPFKESVGKISGEMIMAYPPGIPIIIAGERISQDIIDHIEELKEADLHIQGMEDPE
LETINVIEEEDAIYLYTEKMKNVLIGVQTNLGVNKTGTEFGPDDLIQAYPDTFDEMELIS
VERQKEDFNDKKLKFKNTVLDTCEKIAKRVNEAVIDGYRPILVGGDHSISLGSVSGVSLE
KEIGVLWISAHGDMNTPESTLTGNIHGMPLALLQGLGDRELVNCFYEGAKLDSRNIVIFG
AREIEVEERKIIEKTGVKIVYYDDILRKGIDNVLDEVKDYLKIDNLHISIDMNVFDPEIA
PGVSVPVRRGMSYDEMFKSLKFAFKNYSVTSADITEFNPLNDINGKTAELVNGIVQYMMN
PDY
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattagaccaaaataagacaccattatttacagtattaaaagatgaatatgtg
agaagaaatatacttccatttcatgttcctggacataaaagaggaaaaggagttgatgaa
gaattttataacttcatgggagaggctcctttttcaatagatgtaacaatttttaaaatg
gttgatggtcttcatcatccaaaaagttgtattaaagaatctcaagaattagttgcagat
gcttatggggttaaacatagtttctttgcagtaaatggaacttctggtgctatacaagca
atgataatgtcagttgtaaaagcaggggaaaaaatattagtaccaagaaatgttcataaa
tcagtttcagcaggaattattttaagtggttctgaacctgtgtatatgaatcctgaaatt
gatgaaaatttaggaattgctttaggtgttaaaccacaaacagttgaaaatatgttaaaa
caagatccagacatagcagctgttcttattataaatccaacttattatggggtagcaaca
gatattaaaaagatagcagacatagttcatagctatgatatacctcttattgtagatgaa
gctcatggaccacatttacactttcatgatgaattaccagtttcagctgttgatgctgga
gcagatatctgtactcaaagtacacataaaattttaggtgctatgactcaaatgtctctt
attcatgtaaattcagatagagttaatgttgaaaaagtaaaacaaattttaagtttactc
catacaacttctccatcatatccattgatggcatctcttgattgtgcaagaaggcaaata
gctacacaagggcaagaattgcttacaagaactattgagcttgctaaatattttagaaga
gaagctaatagaatacctggaatttattgttttggagaagaacttgttggaaaagatggt
ttctttgcttttgacccaacaaaaattacaatatctgcaaaagaactaggacttaagggt
ggagagcttgaaagcctacttgtagatgactacaatattcaaatggaattatcagactac
tataacactttagggcttattacaataggagatacagaagaaagtgtaaataaattgcta
gatgctttaagagatataagcagaagattttttggaaaaggaaaaacattagaaaaaaat
attataaaacttcctgaaactcctgaattagtattaatgccaagagaagctttttacagt
gaaaagaataaagttccatttaaagaaagtgttggaaaaatatctggtgaaatgataatg
gcatatccacctggtatcccaataattattgcaggagaaagaataagtcaagatataatt
gatcatattgaagaattaaaagaagctgatttacatattcaaggtatggaagacccagaa
cttgaaaccataaatgtaattgaagaagaagacgctatttacttatacactgaaaagatg
aaaaatgttcttattggagtgcaaacaaatcttggagttaataaaacaggaactgaattt
ggaccagatgatttaattcaagcttatccagatacttttgatgaaatggaattaatttct
gttgaaagacaaaaagaagacttcaatgataaaaaattaaaattcaaaaatacagtttta
gatacttgtgaaaagatagctaagagagttaatgaagctgtaattgatggatatagacca
atacttgttggaggagaccactcaatttcattaggaagtgtatcaggtgtttctctagaa
aaagaaattggagttttatggataagtgctcatggagatatgaatacccctgaaagtaca
cttacaggaaatattcatggaatgccattagctttacttcaaggtctaggagatagggaa
cttgtaaattgtttctatgaaggagctaaacttgacagcagaaatattgttatctttggt
gcaagagaaattgaagttgaagaaagaaaaattattgaaaaaactggtgtaaagattgtt
tattatgatgatattctaagaaaaggtatagataatgttttagacgaagtgaaagattat
ctaaaaattgataatttacatatcagtatagatatgaatgtatttgacccagaaattgct
cctggtgtatctgtacctgttagaagaggaatgtcttatgatgaaatgtttaaatcattg
aaatttgcatttaaaaattactcagttacatcagcagatattacagaatttaatccattg
aatgatattaacggaaaaactgctgaacttgtaaatggtatagtacaatatatgatgaac
ccagattattaa

DBGET integrated database retrieval system