KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0644Help
Entry
FN0644            CDS       T00077                                 

Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00860  Porphyrin and chlorophyll metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FN0644
Enzymes [BR:fnu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     FN0644
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FN0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase Memo
Motif
Other DBs
NCBI-GeneID: 993218
NCBI-ProteinID: NP_603541
UniProt: Q8RFP6
Position
complement(1299977..1301434)
Genome map
AA seq 485 aa AA seqDB search
MKKGKAYIIGAGPGDFELLTIKAKRIIENADCIIYDRLISDDVLKLAKKDAELIYLGKGN
TEGGLIQDEINQTLVNKCLDGKNVARVKGGDPFVFGRGGEEIEALFKNEIEFEVIPGITS
SISVPAYAGIPVTHRGLARSFHIFTGHTMENGKWHNFENIAKLEGTLIFLMGVKNLDLIV
NDLIKYGKDSKTPVAIIEKGATKNQRVTVGNLENILGLVEKNKITPPAITIIGEVVNLRE
TFKWFETENLAKKILVTRDKKQAVEMSENISKRGGIPVELPFIEIENLKIDLKDLEKYKA
ILFNSPNGVKAFFENIKDIRCLANIKIGAVGVKTKEILEKYKIVPDFVPNEYLVDKLAEE
VVKYTNENDNILIVTSDISPCDTDKYNSLYKRNYEKVVAYNTKKLKVDREKVLETLKDID
IITFLSSSTVEAFYENLDGDFFILGDKKIASIGPMTSETIKKLGMKVDYEAEKYTADGLL
DVIFK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggaaaagcatacataattggagcagggccaggagactttgaactattaact
ataaaagcaaaaagaataattgaaaatgcagattgcattatatatgatagattaattagt
gatgatgtattgaaacttgctaaaaaggatgcagagcttatatatcttggaaaaggaaat
actgagggtggtttaattcaagatgaaataaatcaaactcttgtaaataaatgtcttgac
ggaaaaaatgttgctagagtaaaaggtggagacccttttgtctttggtagaggtggagaa
gaaattgaagccttatttaaaaatgaaatagaatttgaagttatcccagggataacttct
tctatatctgtaccagcctatgcaggaatacctgtaacacatagaggacttgcaaggtct
tttcatatttttacagggcatactatggaaaatggaaagtggcataattttgaaaatatt
gcaaaattagagggaactttaatttttttaatgggagttaaaaatttagatttaatagtc
aacgatttaattaaatatggtaaagatagtaaaactcctgttgccattatagaaaaaggt
gcaactaaaaatcaaagagtaacagttggaaatttagaaaatattttaggacttgttgaa
aaaaataaaataactccacctgccataactataattggagaagtagttaatttaagagaa
acttttaaatggtttgaaactgaaaatcttgcaaaaaaaatattagtaacaagagataaa
aaacaagctgttgaaatgtctgaaaatatttctaaaaggggaggaattcctgttgaatta
ccttttatagaaatagaaaatttaaagattgatttaaaagatttagaaaagtataaggct
attttatttaattcacctaatggagttaaagcattctttgaaaatataaaagacataaga
tgtttagcaaatataaaaattggagctgttggagttaaaactaaggaaattttagaaaaa
tataaaatagttccagattttgttcctaatgaatatttagtagataaattagcagaagaa
gtggtgaaatacacaaatgaaaatgataatattttaatagttacttctgatatttctcct
tgtgatacagataaatataattctttatataaaagaaattatgaaaaagttgtagcttat
aatacaaaaaaattaaaagttgatagagagaaagttcttgaaactttaaaagatatagat
attataacttttttaagttcatcaacagtggaagcattttatgaaaatttagatggagat
ttctttattttaggagataaaaaaattgcctctattggacctatgacaagtgaaactata
aaaaaattaggaatgaaagttgattatgaagctgaaaaatatacagctgatggtctgctt
gatgtaatttttaaataa

DBGET integrated database retrieval system