KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0729Help
Entry
FN0729            CDS       T00077                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FN0729
   01230 Biosynthesis of amino acids
    FN0729
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN0729
  Energy metabolism
   00680 Methane metabolism
    FN0729
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0729
Enzymes [BR:fnu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FN0729
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FN0729
  Exosomal proteins of melanoma cells
   FN0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1386494..1387180
Genome map
AA seq 228 aa AA seqDB search
MKLVLIRHGESAWNLENRFTGWKDVDLSPKGMEEAKSAGKILKEMNLVFDVAYTSYLKRA
IKTLNIVLEEMDELYIPVYKSWRLNERHYGALQGLNKAETAKKYGDEQVHIWRRSFDVAP
PSIDKNSEYYPKSDRRYADLADSDIPLGESLKDTIARVLPYWHSDISKSLQEEKNVIVAA
HGNSLRALIKYLLNISNEDILNLNLVTGKPMVFEIDKDLKVLSSPELF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttttaattcgtcatggagaaagtgcatggaacttagaaaatagatttaca
gggtggaaagatgttgatttaagtccaaaaggaatggaagaagcaaaatcagcaggaaaa
attttaaaagaaatgaatttagtttttgatgttgcctatacttcatatttaaaaagagca
atcaaaactttaaatattgttttagaagaaatggatgaattatatattccagtatataaa
tcttggagattaaatgaaagacactatggagcattacaaggattaaataaagcagaaact
gcaaaaaaatatggagatgaacaagtacatatttggcgtcgtagttttgatgtagctcca
ccaagtattgataaaaatagtgaatattatccaaagtcagatagaagatatgcagattta
gcagattctgatattccattaggagagagtttaaaggatacaatagcaagagtattacct
tactggcattctgatatttcaaaaagtttgcaagaagaaaaaaatgttatagttgctgct
catggaaatagtttaagagcattaataaaatatttattaaatatttctaatgaagatatt
ttaaatctaaacttagttacaggaaaacctatggtatttgaaatagataaagatttaaaa
gtgttatcttcacctgaattattttaa

DBGET integrated database retrieval system