KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0730Help
Entry
FN0730            CDS       T00077                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00010  Glycolysis / Gluconeogenesis
fnu00260  Glycine, serine and threonine metabolism
fnu00680  Methane metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
fnu01130  Biosynthesis of antibiotics
fnu01200  Carbon metabolism
fnu01230  Biosynthesis of amino acids
Module
fnu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fnu_M00002  Glycolysis, core module involving three-carbon compounds
fnu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN0730
  Energy metabolism
   00680 Methane metabolism
    FN0730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0730
Enzymes [BR:fnu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FN0730
Membrane trafficking [BR:fnu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    FN0730
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FN0730
  Exosomal proteins of melanoma cells
   FN0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3867 GatB_Yqey zf-C2H2_2 Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 993152
NCBI-ProteinID: NP_603627
UniProt: Q8RFG8
Position
1387217..1387831
Genome map
AA seq 204 aa AA seqDB search
MKKIIIFFLLIIAITGNSEIIKEKKILRKETMELILVCHEKIQSDFENIDLSPSGIEAVK
QLAEKMKKNYSFDIAYTSNLKIANRTLNYILEEMNELEIPINKSETLNTITRKDLEGKNV
FESLKSYWKSDISKNLKEGKNVLIVTDEDTIRILIKYLLDMSDRDIQDVYIPIDNTFYFE
VDKNLEVISAGFPIQKVLERIDEF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataatattttttttactaataatagcaattacaggaaattcagaaata
ataaaagaaaagaagattttaaggaaagaaacaatggaattaattttagtttgtcatgaa
aaaatacaatctgattttgaaaatattgatttaagtcctagtggaatagaagcagtaaaa
caactagctgaaaaaatgaaaaaaaattattcttttgatatagcctatacttctaattta
aaaattgctaacagaactctcaattatatattagaggaaatgaacgaattagagatacct
ataaataaatcagaaacattgaatacgataactcgtaaagacttagaagggaaaaatgtt
tttgaaagtttaaaatcttattggaaatctgatatttctaaaaacttaaaagagggaaaa
aatgtattaatagtaactgatgaagatacaataagaattcttataaagtatttgttagat
atgtcagatagggatatacaagatgtttatatacccatagataacacattttattttgaa
gtagataaaaatttagaggtaatcagtgctggatttcctatacagaaagtgcttgaacga
attgatgaattttaa

DBGET integrated database retrieval system