KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0730Help
Entry
FN0730            CDS       T00077                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FN0730
   01230 Biosynthesis of amino acids
    FN0730
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN0730
  Energy metabolism
   00680 Methane metabolism
    FN0730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0730
Enzymes [BR:fnu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FN0730
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FN0730
  Exosomal proteins of melanoma cells
   FN0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1387217..1387831
Genome map
AA seq 204 aa AA seqDB search
MKKIIIFFLLIIAITGNSEIIKEKKILRKETMELILVCHEKIQSDFENIDLSPSGIEAVK
QLAEKMKKNYSFDIAYTSNLKIANRTLNYILEEMNELEIPINKSETLNTITRKDLEGKNV
FESLKSYWKSDISKNLKEGKNVLIVTDEDTIRILIKYLLDMSDRDIQDVYIPIDNTFYFE
VDKNLEVISAGFPIQKVLERIDEF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataatattttttttactaataatagcaattacaggaaattcagaaata
ataaaagaaaagaagattttaaggaaagaaacaatggaattaattttagtttgtcatgaa
aaaatacaatctgattttgaaaatattgatttaagtcctagtggaatagaagcagtaaaa
caactagctgaaaaaatgaaaaaaaattattcttttgatatagcctatacttctaattta
aaaattgctaacagaactctcaattatatattagaggaaatgaacgaattagagatacct
ataaataaatcagaaacattgaatacgataactcgtaaagacttagaagggaaaaatgtt
tttgaaagtttaaaatcttattggaaatctgatatttctaaaaacttaaaagagggaaaa
aatgtattaatagtaactgatgaagatacaataagaattcttataaagtatttgttagat
atgtcagatagggatatacaagatgtttatatacccatagataacacattttattttgaa
gtagataaaaatttagaggtaatcagtgctggatttcctatacagaaagtgcttgaacga
attgatgaattttaa

DBGET integrated database retrieval system