KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0730Help
Entry
FN0730            CDS       T00077                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FN0730
   01230 Biosynthesis of amino acids
    FN0730
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN0730
  Energy metabolism
   00680 Methane metabolism
    FN0730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FN0730
Enzymes [BR:fnu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FN0730
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FN0730
  Exosomal proteins of melanoma cells
   FN0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1387217..1387831
Genome map
AA seq 204 aa AA seqDB search
MKKIIIFFLLIIAITGNSEIIKEKKILRKETMELILVCHEKIQSDFENIDLSPSGIEAVK
QLAEKMKKNYSFDIAYTSNLKIANRTLNYILEEMNELEIPINKSETLNTITRKDLEGKNV
FESLKSYWKSDISKNLKEGKNVLIVTDEDTIRILIKYLLDMSDRDIQDVYIPIDNTFYFE
VDKNLEVISAGFPIQKVLERIDEF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataatattttttttactaataatagcaattacaggaaattcagaaata
ataaaagaaaagaagattttaaggaaagaaacaatggaattaattttagtttgtcatgaa
aaaatacaatctgattttgaaaatattgatttaagtcctagtggaatagaagcagtaaaa
caactagctgaaaaaatgaaaaaaaattattcttttgatatagcctatacttctaattta
aaaattgctaacagaactctcaattatatattagaggaaatgaacgaattagagatacct
ataaataaatcagaaacattgaatacgataactcgtaaagacttagaagggaaaaatgtt
tttgaaagtttaaaatcttattggaaatctgatatttctaaaaacttaaaagagggaaaa
aatgtattaatagtaactgatgaagatacaataagaattcttataaagtatttgttagat
atgtcagatagggatatacaagatgtttatatacccatagataacacattttattttgaa
gtagataaaaatttagaggtaatcagtgctggatttcctatacagaaagtgcttgaacga
attgatgaattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system