KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0798Help
Entry
FN0798            CDS       T00077                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FN0798
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN0798
   00030 Pentose phosphate pathway
    FN0798
   00051 Fructose and mannose metabolism
    FN0798
  Energy metabolism
   00680 Methane metabolism
    FN0798
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     FN0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1455975..1457912
Genome map
AA seq 645 aa AA seqDB search
MNTEIKYLELLSKTFKNIAETSTEIINLQAIMNLPKGTEHFMTDIHGEYEAFNHVLRNGS
GTIRNKIEEAYGNKLTENEKKELASIIYYPKEKVELMQNKDNFNIDRWMITIIYRLIEVC
KVVCSKYTRSKVRKAMTKDFEYILQELLYEKKELANKKEYFDSIVDTIISIDRGKEFIIA
ICNLIQRLNIDHLHIVGDIYDRGPFPHLIMDTLAEYSNLDIQWGNHDILWIGAALGNKAC
IANVIRICCRYNNNDILEEAYGINLLPFATFAMKYYGDDPCKRFRAKEGVDSDLIAQMHK
AMSIIQFKVEGLYSERNPELEMSSRESLKHINYEKGTINLNGVEYPLNDTNFPTVNPENP
LELLEEEAELLDKLQASFLGSEKLQKHMQLLFAKGGMYLKYNSNLLFHACIPMEPNGEFS
ELFVEDGYYKGKALMDKIDNIVRQAYYDRKNVEVNKKHRDFIWYLWAGRLSPLFGKDVMK
TFERYFIDDKTTHKEIKNPYHKLINDEKVCDKIFEEFGLNPRTSHIINGHIPVKVKEGES
PVKANGKLLIIDGGFSRAYQSTTGIAGYTLTYNSYGMKLASHLKFISKEAAIKDGTDMIS
SHIIVETKSKRMKVKDTDIGKSIQTQINDLKKLLKAYRIGLIKSN
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagagattaaatacttagagttattatctaaaacttttaaaaatattgctgag
acatcaacagaaataataaatttacaagccataatgaatcttcctaagggaactgaacac
ttcatgacagacatacatggagagtatgaggcatttaatcatgttttaagaaatggttcg
ggaaccattagaaacaagattgaagaagcttatggaaataaacttacagagaatgaaaaa
aaagaattggcttcaataatatattatccaaaagaaaaagtcgaacttatgcaaaataaa
gataactttaacatagatagatggatgataactattatttatagactgattgaagtttgt
aaagtagtttgttcaaaatatacaagatcaaaagttagaaaggctatgacaaaagatttt
gaatatattttgcaagaattactttacgaaaaaaaagaattagccaataagaaagaatac
tttgatagtattgttgatactattatttcaatagacagagggaaagaatttataatagca
atctgtaatttaattcaaagattaaatatagatcatttacatatagttggagatatatat
gatagaggtccatttccacatttaataatggatactttagcagaatatagtaatcttgat
atacaatggggaaatcatgatatcctttggataggagcagccctaggaaacaaagcttgt
atagctaatgtaattagaatatgttgtagatataataacaatgacatattagaagaagct
tatggaataaatttattaccttttgcaacttttgctatgaaatattatggcgacgaccct
tgtaaaaggtttagagctaaagagggtgtggatagtgatttaatagcacaaatgcacaaa
gctatgagtataattcaatttaaagttgaaggactttattcagaaagaaatcctgaactt
gaaatgtcatcaagggaatctttaaaacatataaattatgaaaaaggaactattaattta
aatggagtagaatatcctttaaatgacacaaattttccaacagttaatccagaaaaccca
ttggagttattagaggaagaagcagaacttttggataaattacaagcctcttttttagga
agtgaaaagttacaaaaacatatgcaacttttatttgcaaaaggaggaatgtatttaaaa
tacaattcaaatttattatttcatgcttgtatacctatggaaccaaatggagaattcagt
gagctttttgttgaagatggctactataagggtaaagcattaatggataaaatagataat
attgtcagacaagcttattatgatagaaaaaatgttgaagtaaataaaaaacatagagat
tttatttggtatttatgggcaggaagattatctccactttttggaaaagatgttatgaaa
acatttgagagatattttatagatgataaaacaactcataaagaaattaaaaatccctat
cataaattaataaatgatgagaaagtctgtgataaaatttttgaagaatttggtttaaat
ccaagaacttctcatattataaatggacatattccagtcaaggttaaagagggagaatct
cctgtaaaagcaaatggaaaacttttaataatagatggtggtttttcaagagcataccaa
tctacaactggtatagcaggatatacattgacatataactcttatggtatgaaacttgct
tcacatctaaaattcatatctaaagaagcagcaattaaagatggaacagatatgatttct
tcacatataattgttgaaactaagagtaaaagaatgaaagtaaaagatactgatattgga
aaaagtattcaaactcaaataaatgatctaaaaaaattgttaaaggcttatagaataggt
cttatcaaatcaaattag

DBGET integrated database retrieval system