KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0798Help
Entry
FN0798            CDS       T00077                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00010  Glycolysis / Gluconeogenesis
fnu00030  Pentose phosphate pathway
fnu00051  Fructose and mannose metabolism
fnu00680  Methane metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
fnu01130  Biosynthesis of antibiotics
fnu01200  Carbon metabolism
Module
fnu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN0798
   00030 Pentose phosphate pathway
    FN0798
   00051 Fructose and mannose metabolism
    FN0798
  Energy metabolism
   00680 Methane metabolism
    FN0798
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     FN0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-GeneID: 991584
NCBI-ProteinID: NP_603695
UniProt: Q8RFB5
Position
1455975..1457912
Genome map
AA seq 645 aa AA seqDB search
MNTEIKYLELLSKTFKNIAETSTEIINLQAIMNLPKGTEHFMTDIHGEYEAFNHVLRNGS
GTIRNKIEEAYGNKLTENEKKELASIIYYPKEKVELMQNKDNFNIDRWMITIIYRLIEVC
KVVCSKYTRSKVRKAMTKDFEYILQELLYEKKELANKKEYFDSIVDTIISIDRGKEFIIA
ICNLIQRLNIDHLHIVGDIYDRGPFPHLIMDTLAEYSNLDIQWGNHDILWIGAALGNKAC
IANVIRICCRYNNNDILEEAYGINLLPFATFAMKYYGDDPCKRFRAKEGVDSDLIAQMHK
AMSIIQFKVEGLYSERNPELEMSSRESLKHINYEKGTINLNGVEYPLNDTNFPTVNPENP
LELLEEEAELLDKLQASFLGSEKLQKHMQLLFAKGGMYLKYNSNLLFHACIPMEPNGEFS
ELFVEDGYYKGKALMDKIDNIVRQAYYDRKNVEVNKKHRDFIWYLWAGRLSPLFGKDVMK
TFERYFIDDKTTHKEIKNPYHKLINDEKVCDKIFEEFGLNPRTSHIINGHIPVKVKEGES
PVKANGKLLIIDGGFSRAYQSTTGIAGYTLTYNSYGMKLASHLKFISKEAAIKDGTDMIS
SHIIVETKSKRMKVKDTDIGKSIQTQINDLKKLLKAYRIGLIKSN
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagagattaaatacttagagttattatctaaaacttttaaaaatattgctgag
acatcaacagaaataataaatttacaagccataatgaatcttcctaagggaactgaacac
ttcatgacagacatacatggagagtatgaggcatttaatcatgttttaagaaatggttcg
ggaaccattagaaacaagattgaagaagcttatggaaataaacttacagagaatgaaaaa
aaagaattggcttcaataatatattatccaaaagaaaaagtcgaacttatgcaaaataaa
gataactttaacatagatagatggatgataactattatttatagactgattgaagtttgt
aaagtagtttgttcaaaatatacaagatcaaaagttagaaaggctatgacaaaagatttt
gaatatattttgcaagaattactttacgaaaaaaaagaattagccaataagaaagaatac
tttgatagtattgttgatactattatttcaatagacagagggaaagaatttataatagca
atctgtaatttaattcaaagattaaatatagatcatttacatatagttggagatatatat
gatagaggtccatttccacatttaataatggatactttagcagaatatagtaatcttgat
atacaatggggaaatcatgatatcctttggataggagcagccctaggaaacaaagcttgt
atagctaatgtaattagaatatgttgtagatataataacaatgacatattagaagaagct
tatggaataaatttattaccttttgcaacttttgctatgaaatattatggcgacgaccct
tgtaaaaggtttagagctaaagagggtgtggatagtgatttaatagcacaaatgcacaaa
gctatgagtataattcaatttaaagttgaaggactttattcagaaagaaatcctgaactt
gaaatgtcatcaagggaatctttaaaacatataaattatgaaaaaggaactattaattta
aatggagtagaatatcctttaaatgacacaaattttccaacagttaatccagaaaaccca
ttggagttattagaggaagaagcagaacttttggataaattacaagcctcttttttagga
agtgaaaagttacaaaaacatatgcaacttttatttgcaaaaggaggaatgtatttaaaa
tacaattcaaatttattatttcatgcttgtatacctatggaaccaaatggagaattcagt
gagctttttgttgaagatggctactataagggtaaagcattaatggataaaatagataat
attgtcagacaagcttattatgatagaaaaaatgttgaagtaaataaaaaacatagagat
tttatttggtatttatgggcaggaagattatctccactttttggaaaagatgttatgaaa
acatttgagagatattttatagatgataaaacaactcataaagaaattaaaaatccctat
cataaattaataaatgatgagaaagtctgtgataaaatttttgaagaatttggtttaaat
ccaagaacttctcatattataaatggacatattccagtcaaggttaaagagggagaatct
cctgtaaaagcaaatggaaaacttttaataatagatggtggtttttcaagagcataccaa
tctacaactggtatagcaggatatacattgacatataactcttatggtatgaaacttgct
tcacatctaaaattcatatctaaagaagcagcaattaaagatggaacagatatgatttct
tcacatataattgttgaaactaagagtaaaagaatgaaagtaaaagatactgatattgga
aaaagtattcaaactcaaataaatgatctaaaaaaattgttaaaggcttatagaataggt
cttatcaaatcaaattag

DBGET integrated database retrieval system