KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN0858Help
Entry
FN0858            CDS       T00077                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FN0858
Enzymes [BR:fnu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FN0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1519077..1520597)
Genome map
AA seq 506 aa AA seqDB search
MKRECGVLLAISSLPSSYGIGDFGKEAYRFIDFLVSSGQSLWQILPLCPVEYGNSPYQSP
STFAGNFLYLDLENLVNNEYLTQKDIDVLKQEVSYIDYEYIKSQKESLLRKASQAFFYKK
KEEKDFKKFQKENKFWLEDYALFLTLNKKFKGKMWNTWQKEYKFREKKFIEEAKKTYQEE
YLYESFIQYYFQKQWKQLKNYANKKGIKIIGDLPIYVATHSADTWQNPKLFCFDKHLKIK
LVAGCPPDYFSKTGQLWGNVLYNWKEMKKNDYSWWINRIKHSFLLYDILRLDHFRGFASY
WAIRYGEKTAINGKWEKGPRYQFFKKLESKITNMDVVAEDLGTLTADVFKLLEQTKYPNM
KVLEFGLAEWDNMYHPRNYLENSVAYTGTHDNMPIVEWYENLNQEEKNICDENLKNFLKD
YDTNIWEPIQWRAIEALYASKSNRVIVPLQDILGLGRDSRMNTPSTVGNNWAWRIYWNYR
YKDLENKLYNLAKKYRRISKGEDNEN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagagaatgtggagttttattagcaattagttctctaccaagttcttatggcatt
ggagattttgggaaagaagcatatcgttttattgatttcttagtgtcctctggacaaagt
ctgtggcaaatattaccactgtgtcctgtggaatatggaaactctccctatcaatcacct
tctacttttgctggaaattttttatatttagatttagaaaatttagttaataatgaatat
ttaacacaaaaggatattgatgtattaaaacaagaagtatcctatatagattatgaatat
attaaaagccagaaagagtctttattaagaaaggcttctcaggcttttttttacaaaaag
aaagaagaaaaagattttaaaaaatttcaaaaagaaaataaattttggttagaagattat
gcactttttcttactttaaataagaaatttaaaggtaaaatgtggaatacttggcaaaaa
gaatataaatttagagagaagaaatttatagaagaagctaagaagacctatcaagaagaa
tatctatatgaaagttttatacaatattattttcaaaaacaatggaaacaattaaaaaat
tatgcaaataaaaaaggaataaaaattataggtgatttacctatatatgttgcaacacat
agtgctgatacttggcaaaatccaaaattattctgttttgataaacatttaaaaataaaa
ttggtggcaggttgcccaccagattatttttctaaaactggacaattatggggaaatgtt
ctttataattggaaagagatgaaaaaaaatgactattcttggtggataaatagaataaaa
catagttttttactttatgatattttaagactagatcattttagaggttttgcatcttat
tgggctattcgttatggagaaaaaactgcaatcaatggaaaatgggaaaaaggacctaga
tatcaattttttaaaaaattagaaagcaaaataactaatatggatgtagtggcagaagat
ttaggaacacttacagcagatgtttttaaacttttagaacagacaaagtatccaaatatg
aaagtattggaatttggtttagctgaatgggataatatgtaccatcctagaaattatctt
gaaaattcagttgcctatacgggcacacatgataatatgccaatagttgagtggtatgaa
aatttaaatcaagaagaaaaaaatatctgtgatgagaatttaaaaaactttttaaaagac
tatgatacaaatatttgggaaccaattcaatggagagcaatagaagcactttatgcttca
aaatctaatagggttatagtccctctacaagatatactaggtttaggtagggattcaaga
atgaatactccttcaacagttgggaacaattgggcttggagaatttattggaattataga
tacaaggatttagaaaataaattatataatttagcaaagaaatatagaagaattagtaag
ggagaggataatgaaaattga

DBGET integrated database retrieval system