KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1104Help
Entry
FN1104            CDS       T00077                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FN1104
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FN1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749593..1750177
Genome map
AA seq 194 aa AA seqDB search
MFEYLYGTVEYKKMDYIAIDINGVGYRVYFPLREYEKIEVGNKYKLYIYNHIKEDTYKLI
GFLDERDRKIFELLLKINGIGSSLALAVLSNFSYNKIIEIISKNDYTTLRQVPKLGEKKA
QIIILDLKGKLKNLTYTEEETVSMDMLEDLVLALEGLGYNKKEIDKTLEKIDLNKFSSLE
DAIKGILKNMRIGD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatctatatggaacagttgaatataagaaaatggattatatagccattgat
ataaatggtgttggttatagggtatattttccacttagagaatatgaaaaaatagaagta
ggaaataaatataaactttatatatataatcacattaaagaggatacatataagttaatt
ggatttttagatgaaagagatagaaaaatatttgaattattattaaaaataaatggaata
ggctcatctttagcattagcagttttatcaaatttttcatataataaaattattgaaatt
atttcaaaaaatgattatactactcttaggcaagttccaaaattaggagaaaaaaaggca
caaattattatcttagatttgaaaggaaaattaaaaaatcttacttatacagaagaagaa
acagtttctatggatatgttagaagatttagttttagcattggaaggcttaggatacaat
aaaaaagaaattgataaaactctagaaaaaattgatttgaataaattttcttctttggaa
gatgcaataaaaggaattttaaaaaatatgagaataggagattag

DBGET integrated database retrieval system