KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1104Help
Entry
FN1104            CDS       T00077                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fnu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749593..1750177
Genome map
AA seq 194 aa AA seqDB search
MFEYLYGTVEYKKMDYIAIDINGVGYRVYFPLREYEKIEVGNKYKLYIYNHIKEDTYKLI
GFLDERDRKIFELLLKINGIGSSLALAVLSNFSYNKIIEIISKNDYTTLRQVPKLGEKKA
QIIILDLKGKLKNLTYTEEETVSMDMLEDLVLALEGLGYNKKEIDKTLEKIDLNKFSSLE
DAIKGILKNMRIGD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatctatatggaacagttgaatataagaaaatggattatatagccattgat
ataaatggtgttggttatagggtatattttccacttagagaatatgaaaaaatagaagta
ggaaataaatataaactttatatatataatcacattaaagaggatacatataagttaatt
ggatttttagatgaaagagatagaaaaatatttgaattattattaaaaataaatggaata
ggctcatctttagcattagcagttttatcaaatttttcatataataaaattattgaaatt
atttcaaaaaatgattatactactcttaggcaagttccaaaattaggagaaaaaaaggca
caaattattatcttagatttgaaaggaaaattaaaaaatcttacttatacagaagaagaa
acagtttctatggatatgttagaagatttagttttagcattggaaggcttaggatacaat
aaaaaagaaattgataaaactctagaaaaaattgatttgaataaattttcttctttggaa
gatgcaataaaaggaattttaaaaaatatgagaataggagattag

DBGET integrated database retrieval system