KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1104Help
Entry
FN1104            CDS       T00077                                 

Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FN1104
Enzymes [BR:fnu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FN1104
DNA repair and recombination proteins [BR:fnu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FN1104
    RecFOR pathway proteins
     FN1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749593..1750177
Genome map
AA seq 194 aa AA seqDB search
MFEYLYGTVEYKKMDYIAIDINGVGYRVYFPLREYEKIEVGNKYKLYIYNHIKEDTYKLI
GFLDERDRKIFELLLKINGIGSSLALAVLSNFSYNKIIEIISKNDYTTLRQVPKLGEKKA
QIIILDLKGKLKNLTYTEEETVSMDMLEDLVLALEGLGYNKKEIDKTLEKIDLNKFSSLE
DAIKGILKNMRIGD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatctatatggaacagttgaatataagaaaatggattatatagccattgat
ataaatggtgttggttatagggtatattttccacttagagaatatgaaaaaatagaagta
ggaaataaatataaactttatatatataatcacattaaagaggatacatataagttaatt
ggatttttagatgaaagagatagaaaaatatttgaattattattaaaaataaatggaata
ggctcatctttagcattagcagttttatcaaatttttcatataataaaattattgaaatt
atttcaaaaaatgattatactactcttaggcaagttccaaaattaggagaaaaaaaggca
caaattattatcttagatttgaaaggaaaattaaaaaatcttacttatacagaagaagaa
acagtttctatggatatgttagaagatttagttttagcattggaaggcttaggatacaat
aaaaaagaaattgataaaactctagaaaaaattgatttgaataaattttcttctttggaa
gatgcaataaaaggaattttaaaaaatatgagaataggagattag

DBGET integrated database retrieval system