KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1164Help
Entry
FN1164            CDS       T00077                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FN1164
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN1164
   00052 Galactose metabolism
    FN1164
   00500 Starch and sucrose metabolism
    FN1164
   00520 Amino sugar and nucleotide sugar metabolism
    FN1164
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FN1164
   00524 Butirosin and neomycin biosynthesis
    FN1164
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FN1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1821894..1822841
Genome map
AA seq 315 aa AA seqDB search
MKHYIGIDLGGTNTKIGVVDSEGNLINSKIIKTHSHQNVDKTLERIWETAKKLILEKEIP
LFSVVGIGIGIPGPVKNQSTVGFFANFDWEKNLNLKEKMEKLSGIETRIENDANIIAQGE
AIFGAAKGKKSSITIAIGTGIGGGIFYNGNLISGMSGVGGEIGHMKVVKDGKTCGCGQNG
CFEAYASASSLVKEAKERLKLNEDNLLFKEINGDLDELEAKNIFDAARKGDQFSKDLIEY
ESDYLALGIGNLLNIINPECIVISGGISLAGDEILLPIKEKLKKYTMPPALENLEIKIGT
LGNEAGVKGAVALFI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattatattggtattgatttaggtggaaccaacacaaaaataggagtagttgat
tcagagggaaatttgataaatagcaaaattattaaaactcactctcatcaaaatgttgat
aaaacacttgaaagaatttgggaaactgcaaaaaaattgatattagaaaaagaaattcca
cttttttctgttgtaggaataggaattggtattccaggacctgtaaaaaaccaaagtaca
gtaggtttctttgcaaattttgattgggaaaaaaatcttaatttgaaagaaaaaatggaa
aagttaagtggaatagaaacaagaattgaaaatgatgctaatataattgcacaaggtgaa
gctatttttggagctgcaaaaggaaaaaaatcttcaataactattgcaataggaacagga
ataggcggaggaattttttataatggaaaccttatttctggtatgtctggtgtaggtgga
gaaataggacatatgaaggtggttaaagatggtaaaacttgtggttgtggacaaaatggt
tgttttgaagcttatgcctcagctagctctcttgttaaagaggcaaaagagagattaaaa
ttaaatgaagataatttactttttaaggagattaatggagatttagatgaacttgaagca
aaaaatatttttgatgctgctagaaagggagatcaattttcaaaagatttaatagaatac
gaaagtgattatttagctttaggaataggaaatcttttaaatataataaatcctgaatgt
attgttataagtggaggtatttctcttgcaggagatgaaattttacttccaataaaagaa
aaattaaaaaaatatactatgcctcctgctcttgaaaatttagaaattaaaatagggact
ttgggtaatgaagcaggtgtaaaaggagctgtggcactttttatttag

DBGET integrated database retrieval system