KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1164Help
Entry
FN1164            CDS       T00077                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00010  Glycolysis / Gluconeogenesis
fnu00052  Galactose metabolism
fnu00500  Starch and sucrose metabolism
fnu00520  Amino sugar and nucleotide sugar metabolism
fnu00521  Streptomycin biosynthesis
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
fnu01130  Biosynthesis of antibiotics
fnu01200  Carbon metabolism
Module
fnu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fnu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN1164
   00052 Galactose metabolism
    FN1164
   00500 Starch and sucrose metabolism
    FN1164
   00520 Amino sugar and nucleotide sugar metabolism
    FN1164
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FN1164
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FN1164
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FN1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Glucokinase BcrAD_BadFG Hydant_A_N Pan_kinase Hexokinase_1 RuvC Tex_YqgF
Motif
Other DBs
NCBI-GeneID: 991920
NCBI-ProteinID: NP_604061
UniProt: Q8REE3
Position
1821894..1822841
Genome map
AA seq 315 aa AA seqDB search
MKHYIGIDLGGTNTKIGVVDSEGNLINSKIIKTHSHQNVDKTLERIWETAKKLILEKEIP
LFSVVGIGIGIPGPVKNQSTVGFFANFDWEKNLNLKEKMEKLSGIETRIENDANIIAQGE
AIFGAAKGKKSSITIAIGTGIGGGIFYNGNLISGMSGVGGEIGHMKVVKDGKTCGCGQNG
CFEAYASASSLVKEAKERLKLNEDNLLFKEINGDLDELEAKNIFDAARKGDQFSKDLIEY
ESDYLALGIGNLLNIINPECIVISGGISLAGDEILLPIKEKLKKYTMPPALENLEIKIGT
LGNEAGVKGAVALFI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattatattggtattgatttaggtggaaccaacacaaaaataggagtagttgat
tcagagggaaatttgataaatagcaaaattattaaaactcactctcatcaaaatgttgat
aaaacacttgaaagaatttgggaaactgcaaaaaaattgatattagaaaaagaaattcca
cttttttctgttgtaggaataggaattggtattccaggacctgtaaaaaaccaaagtaca
gtaggtttctttgcaaattttgattgggaaaaaaatcttaatttgaaagaaaaaatggaa
aagttaagtggaatagaaacaagaattgaaaatgatgctaatataattgcacaaggtgaa
gctatttttggagctgcaaaaggaaaaaaatcttcaataactattgcaataggaacagga
ataggcggaggaattttttataatggaaaccttatttctggtatgtctggtgtaggtgga
gaaataggacatatgaaggtggttaaagatggtaaaacttgtggttgtggacaaaatggt
tgttttgaagcttatgcctcagctagctctcttgttaaagaggcaaaagagagattaaaa
ttaaatgaagataatttactttttaaggagattaatggagatttagatgaacttgaagca
aaaaatatttttgatgctgctagaaagggagatcaattttcaaaagatttaatagaatac
gaaagtgattatttagctttaggaataggaaatcttttaaatataataaatcctgaatgt
attgttataagtggaggtatttctcttgcaggagatgaaattttacttccaataaaagaa
aaattaaaaaaatatactatgcctcctgctcttgaaaatttagaaattaaaatagggact
ttgggtaatgaagcaggtgtaaaaggagctgtggcactttttatttag

DBGET integrated database retrieval system