KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1225Help
Entry
FN1225            CDS       T00077                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--meso-lanthionine ligase (EC:6.3.2.-)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    FN1225
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FN1225
Enzymes [BR:fnu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     FN1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1883456..1884913)
Genome map
AA seq 485 aa AA seqDB search
MNIFSGIEYKVLKDVNLDRKYDGIEYDSRKIKENYIFVAFEGANVDGHNYIDSAVKNGAT
CIIVSKKVEMKHNVSYILIDDIRHKLGYIASNFYEWPQRKLKIIGVTGTNGKTSSTYMIE
KLMGDIPITRIGTIEYKIGDKVFEAVNTTPESLDLIKIFDKTLKKKIEYVIMEVSSHSLE
IGRVEVLDFDYALFTNLTQDHLDYHLTMENYFQAKRKLFLKLKDINNSVINVDDEYGKRL
YDEFIVDNPEIISYGIENGDLEGDYSDDGYIDVKYKNQIEKVKFSLLGDFNLYNTLGAIG
IALKIGISMEEILKRVSNIKAAPGRFEALDCGQDYKVIVDYAHTPDALVNVIVAARNIKN
GSRIITIFGCGGDRDRTKRPIMAKVAEDLSDVVILTSDNPRTESPEQIFDDVKKGFIKSD
DYFFEPDREKAIKLAINMAEKNDIILITGKGHETYHIIGTKKWHFDDKEIARREIVRRKM
VENVN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttttcagggatagaatataaagttttaaaagatgtaaatttagatagaaaa
tatgatggtattgaatatgattcaaggaaaataaaagaaaattatatatttgttgcattt
gaaggggctaatgttgacgggcataactatatagatagtgcagtaaaaaatggagctact
tgtataattgttagcaaaaaagttgagatgaaacataatgtcagttatattttaatagat
gatataagacataaacttggatatattgcttcaaatttttatgaatggcctcaaagaaaa
ttaaaaattattggagttacaggaacaaatggtaagacttcatcaacttatatgatagaa
aaattaatgggagatattccaataactcgtataggaacaatagaatacaaaataggggat
aaagtatttgaagcagttaataccactcctgaatctcttgacttaataaaaatttttgat
aagactttaaagaaaaaaattgaatatgttataatggaggtaagttcacattcgcttgaa
ataggtagagttgaagtgcttgattttgattatgcactatttactaatttaactcaggac
catttagattatcatttaactatggaaaattattttcaagctaaaagaaaattattttta
aaattgaaagatataaataattctgtaattaatgttgatgatgaatatggaaaaagatta
tatgatgaatttatagttgataatcctgaaataatctcttatggaatagaaaatggagat
ttagaaggggattattcagatgatggctatattgatgtaaaatataaaaatcaaattgaa
aaagttaaattttcattattaggggattttaatttatataataccttaggagctattgga
attgctttaaaaattggtattagtatggaagaaattttaaaaagagtttcaaatataaaa
gcagcaccaggaagattcgaagccttagattgtggacaagattataaagtaatagtagat
tatgcacatacacctgatgctttagtaaatgtaatagtggcagctagaaatattaaaaat
ggaagtagaataataacaatctttggttgtggtggagatagagatagaactaaaagacct
ataatggcaaaggtagcagaagatttatcagatgttgtaatacttacttctgataatcca
agaacagaatctcctgaacaaatatttgatgatgtgaaaaaaggctttataaaatcagat
gattatttctttgaacctgatagagaaaaagcaataaagttagctatcaatatggcagaa
aaaaatgatataatattaatcacaggtaagggacatgaaacttatcatataattggaact
aaaaaatggcattttgatgataaagaaattgcaagaagagaaattgtcagaagaaagatg
gtggaaaatgttaattaa

DBGET integrated database retrieval system