KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1266Help
Entry
FN1266            CDS       T00077                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:fnu00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fnu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fnu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fnu00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1922248..1923153)
Genome map
AA seq 301 aa AA seqDB search
MSLKEAFMKKVTKAVIPAAGLGTRVLPATKALPKEMLTIVDKPSLQYIVEELVDSGITDI
VIITGRNKNSIEDHFDFSYELENTLKNDNKLDLLEKVSHISNIANIYYVRQSMPLGLGHA
VLKAKSFIGDEPFVIALGDDIIYNPEKPVTKQMIEKYELYGKSIIGCQEVAKEDVSKYGI
AKLGHKVDETTYQMLDFLEKPSVNEAPSRTACLGRYLLSGKVFKYLEETKPGKNGEIQLT
DGILAMMRDNEEVLAYNFIGKRYDIGSKFGLLRANIEFGLRNEETKEEVKEYLKKLDIEK
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaaggaggcttttatgaaaaaagttactaaggctgttatacctgctgctggt
ttaggaacaagagttttaccagcaacaaaagcactgccaaaggaaatgcttacaatagtt
gataaaccatctttacaatatatagttgaggagttagttgactctggaataacagatatt
gtaataataacaggaagaaataaaaattcaatagaagatcatttcgatttttcttatgaa
ttagaaaatactttaaaaaatgataataaattagatttattagaaaaagtttcacatata
tcaaatattgcaaatatttactatgtaagacaaagtatgccacttggtttaggacatgca
gtattaaaagctaaatcttttattggagatgaaccctttgttattgctttaggagatgac
atcatatataatcctgaaaaaccagttactaaacaaatgattgaaaaatatgagctttat
ggaaagagcataataggatgtcaagaagtagcaaaagaagatgtttctaaatatggtata
gcaaaattagggcataaggttgatgaaactacttatcagatgttagattttttagaaaag
ccctctgtaaatgaagctccttcaagaacagcttgtttaggaaggtatttactttcagga
aaagtatttaaatatttagaggaaacaaaacctggaaaaaatggagaaatccaattaaca
gatggaatacttgctatgatgcgagataatgaagaggttttagcatataattttattggc
aaaagatatgatataggaagtaaatttggattacttagagctaatattgagtttggactt
agaaatgaagaaacaaaagaagaagttaaagaatatctaaaaaaattagatatagaaaaa
atataa

DBGET integrated database retrieval system