KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1366Help
Entry
FN1366            CDS       T00077                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00010  Glycolysis / Gluconeogenesis
fnu00051  Fructose and mannose metabolism
fnu01100  Metabolic pathways
fnu01110  Biosynthesis of secondary metabolites
fnu01120  Microbial metabolism in diverse environments
fnu01130  Biosynthesis of antibiotics
fnu01200  Carbon metabolism
fnu01230  Biosynthesis of amino acids
Module
fnu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fnu_M00002  Glycolysis, core module involving three-carbon compounds
fnu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FN1366
   00051 Fructose and mannose metabolism
    FN1366
   00562 Inositol phosphate metabolism
    FN1366
Enzymes [BR:fnu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FN1366
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FN1366
  Exosomal proteins of bladder cancer cells
   FN1366
  Exosomal proteins of melanoma cells
   FN1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Mor DUF3793
Motif
Other DBs
NCBI-GeneID: 992250
NCBI-ProteinID: NP_604263
UniProt: Q8RDX7
Position
complement(2016853..2017608)
Genome map
AA seq 251 aa AA seqDB search
MRRLVIAGNWKMYKNNKEAVETLTQLKDLTRDVKNVDIVIGAPFTCLSDAVKIVEGSNVK
IAAENVYPKIEGAYTGEVSPKMLKDIGVTYVILGHSERREYFKESDEFINQKVKAVLEIG
MKPILCIGEKLEDREGGKTLEVLAKQIKEGLVDLSKEDAEKTIVAYEPVWAIGTGKTATP
EMAQETHKEIRNVLAEMFGKDVADKMIIQYGGSMKPENAKDLLSQEDIDGGLVGGASLKA
DSFFEIIKAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagattagttattgctggaaattggaaaatgtataaaaataataaagaggctgtt
gaaacattgacacaactaaaagatttaacaagggatgtaaaaaatgtagatatagttata
ggagcaccttttacttgtctttcagatgcagttaaaattgttgaaggaagtaatgtaaaa
atagcagcagaaaatgtatatcctaaaatagaaggagcgtatacaggagaagtttctcct
aaaatgcttaaagatattggagttacttatgtaattttaggacactctgaaagaagagaa
tattttaaagaaagtgatgaatttataaatcaaaaagttaaggcagttttagaaatagga
atgaaacctatactttgtattggagaaaagttagaagatagagaaggaggaaaaactctt
gaagttctagctaaacaaatcaaagaaggtcttgttgatttatctaaggaagatgcagaa
aaaactatagttgcttatgaaccagtttgggcaataggaacaggaaaaacagcaactcca
gaaatggcacaagaaactcataaggaaattagaaatgtcttagcagaaatgtttggaaaa
gatgtggcagataagatgataattcaatatggtggttcaatgaaaccagaaaatgcaaaa
gatttattaagtcaagaagatattgatggtggtcttgttggaggagcttcattaaaggca
gattcattttttgaaattataaaagcaggaaattaa

DBGET integrated database retrieval system