KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1520Help
Entry
FN1520            CDS       T00077                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fnu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:fnu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(24892..26163)
Genome map
AA seq 423 aa AA seqDB search
MVEAFKIIGGKKIAGELKVDGSKNSTLPIMIATLVEKGTYVLRNVPDLRDIRTLVALLES
LGLEVEKLDANSYKIINNGLSGAEASYDLVKKMRASFLVMGGMLAIEKRGKVALPGGCAI
GARPVDLHLKGFEALGAKINIEHGYVEATTENGLIGGNIVLDFPSVGATENIIMAAVKAK
GKTVLENAAKEPEIEDLCNFLIKMGAKISGVGTSRLEIDGVDKLTACEYTIIPDRIVAGT
YIIASILFDGSIKVSGIVPEHLSSFLLKLEEMGTKFKIEGDKLEVLTKLSDLKPAKVTTM
PHPGFPTDLQSPMMTLMCLVNGTSEIKETIFENRFMHVPELNRMGAKIEIDSSTAKITGV
ENFSSAEVMASDLRAGASLILAALKANGESLVNRIYHVDRGYENFEEKFKALGANIERIK
TEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagcatttaaaataattggtggaaaaaaaatagcaggggaattaaaagttgat
ggttcaaaaaattcaacactcccaataatgatagcaacattagttgagaaaggaacttat
gttttaagaaatgttcctgatttaagagatattagaactttggttgcactcttagaaagc
ttaggattggaagtagaaaaattagatgctaattcatataaaataataaataatggactt
agtggagcagaagcaagctatgatttagttaaaaagatgagagcttcatttttagtaatg
ggtggaatgcttgccattgaaaaaagaggaaaagttgccctaccaggtggttgtgcaata
ggggcaagacctgttgatttacatttaaaaggttttgaagccttaggagcaaaaataaat
atagaacatggatatgttgaagctacaacagaaaatggtttaattggtgggaatatagtt
cttgatttcccaagtgttggagcaacagaaaatataataatggcagctgttaaggctaaa
ggaaaaactgttttagaaaatgctgcaaaagaaccagaaatagaagatttatgtaatttt
ttaataaaaatgggagcaaaaataagtggggtaggaacaagtagacttgaaattgatgga
gtggataaattgactgcttgtgaatatactataattccagataggatagttgcagggaca
tatataatagcttctatcttatttgatggaagtataaaagtttctggaatagttccagaa
catctatcaagtttcttattaaaacttgaagaaatgggaactaaatttaaaatagaagga
gataaattagaagttttaacaaaattatctgatttaaaacctgcaaaggtaacaactatg
ccacaccctggttttccaacagatttacaatctccaatgatgacacttatgtgtttagta
aatgggacaagtgaaataaaagaaacaatatttgaaaatagatttatgcatgtgccagaa
cttaatagaatgggagcaaaaatagaaattgactcatcaactgctaaaataacaggagtt
gaaaatttctcatcagcagaagtaatggcaagtgatttaagagcaggggcatcacttata
cttgcagcactgaaagcaaatggtgaaagtttagtaaatagaatttaccatgtggacaga
ggatatgaaaactttgaagaaaaatttaaggctttgggagcaaatatagaaagaattaag
acagaagcctag

DBGET integrated database retrieval system