KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1839Help
Entry
FN1839            CDS       T00077                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FN1839 (glpK)
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FN1839 (glpK)
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FN1839 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328412..329905
Genome map
AA seq 497 aa AA seqDB search
MKYIVALDQGTTSSRAILFDESQNIIGVAQKEFTQIYPNEGWVEHDPMEIWSSQSGVLSE
VIARAGISQHDIIALGITNQRETTIVWDKNTGKPVYNAIVWQCRRTAKICDELKEIEGFS
DYVKDNTGLLVDAYFSGTKIKWILDNVEGARERAEKGELLFGTVDTWLIWKLTNGKIHAT
DYTNASRTMLYNIKELKWDEKILETLNIPKSMLPEVKDSSGTFGYANLGGKGGHRIPIAG
VAGDQQSALFGQACFEEGESKNTYGTGCFLLMNTGEKFVKSNNGLITTIAIGLNGKVQYA
LEGSVFVGGASVQWLRDELKLISDSKDTEYFARKVKDSAGVYVVPAFVGLGAPYWDMYAR
GAILGLTRGANKNHIIRATLESIAYQTKDVLKAMEEDSGIKLNGLKVDGGAAANNFLMEF
QADILGESVKRPTVLETTALGAAYLAGLAVGFWENKNEIKQKWVLDKEFTPNMPKEERDK
KYAGWLKAVERTKKWEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattgtagcattagatcaaggtacaacaagttcaagagcaattttatttgat
gaaagccaaaatataattggagtagctcaaaaagaatttacacaaatctatccaaatgaa
ggttgggttgaacatgacccaatggaaatatggtcaagtcaaagtggggttttaagtgaa
gttattgctagagctggaataagtcaacatgatattatagcactaggaatcacaaatcaa
agagaaactacaatagtttgggataaaaatacagggaaacctgtttacaatgcaatagtt
tggcaatgtagaagaactgctaaaatctgtgatgaattaaaagaaatcgaaggttttagt
gactatgttaaagataatacaggacttctagttgatgcttacttctcaggaactaaaata
aaatggattttagacaatgtagaaggtgcaagagaaagagctgaaaaaggagaacttttg
tttggaactgttgatacttggttaatttggaaattaactaatggaaaaatccatgcaaca
gattacactaatgcttcaagaactatgctttataatattaaagaattaaaatgggatgaa
aaaatattagaaactttaaatattcctaaatcaatgttaccagaagttaaagattcaagt
gggacatttggttatgcaaatcttggaggaaagggtggacatagaataccaatagcagga
gtagcaggagatcaacaatctgcattatttggacaagcttgttttgaagaaggagaatct
aaaaatacttatggaacaggttgtttcttgcttatgaatacaggagaaaaatttgtaaag
agtaacaatggacttattacaactattgcaataggacttaatggaaaagttcaatatgca
cttgaaggaagtgtatttgtaggtggagctagtgttcaatggttaagagatgaattaaaa
ttaatttctgattcaaaagatactgaatattttgctagaaaagttaaagatagtgcaggg
gtatatgtagttccagcatttgtaggattaggtgcaccttattgggatatgtatgctaga
ggagcaattttaggtttaactcgtggagcaaataagaaccatattataagagcaactttg
gaatcaatagcttaccaaacaaaagatgttctaaaagctatggaagaagattctggaata
aaattaaatggtcttaaagttgatggtggagcagcagctaataatttcttaatggaattt
caagcagatattttaggagaatctgtaaagagacctactgtattagaaacaactgcctta
ggagcagcatatcttgcaggacttgcagttggattctgggaaaataaaaatgaaattaaa
caaaaatgggtattggataaagaatttacacctaatatgccaaaagaagaaagagacaaa
aaatatgctggttggttaaaagctgttgaaagaactaagaaatgggaagaataa

DBGET integrated database retrieval system