KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1847Help
Entry
FN1847            CDS       T00077                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:1.1.1.133 5.1.3.13)
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    FN1847
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FN1847
Enzymes [BR:fnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     FN1847
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     FN1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336282..337268
Genome map
AA seq 328 aa AA seqDB search
MMKVLLTGATGFLGKYVIDELKNNSYQVVAFGRNEKIGHTLIDENVEFYKGDIDNLDDLF
KASQDCSAVIHAAALSTVWGKWKDFYNVNVLGTKNVVQVCEEKNLKLVFVSSPSIYAGAK
DQLDVKEDEAPKENDLNYYIKSKIMAENIIKSSKLNYMIIRPRGLFGVGDTSIIPRLLEL
NKKIGIPLFVDGKQKVDITCVENVAYALRLALENNQYSRKIYNITNDEPIEFKEILTLFF
NEMGTEGKYLKWNYNLISPLVSFLEIFYKLFRIKKEPPITKYTLYLMRYSQTLNIDKAKK
ELGYYPKMSILEGVKKYVEHSRKNDRES
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggttttacttacaggagcaacaggatttttaggaaaatatgtaattgatgaa
ttaaaaaataactcttatcaagttgttgcctttggtagaaatgaaaaaattggacataca
ttgattgatgaaaatgttgaattttataaaggcgatatagataatttagatgatttattt
aaggcttcccaagattgttcagctgttatacatgctgctgcactttctactgtttggggt
aaatggaaagatttctataatgtaaatgtattagggacaaaaaatgttgttcaagtttgt
gaagaaaaaaatttaaaattagtctttgtttcatctccaagtatatatgcaggagcaaaa
gaccaattagatgttaaagaagacgaggcaccaaaagagaatgatttgaactactatata
aaaagtaaaattatggcagaaaatataattaaatcttctaagctaaactatatgataatt
cgtcctcgtggactatttggagtaggagatacaagtataataccaagacttttagaatta
aataagaaaattggtattcctctttttgttgatggaaaacaaaaggttgatataacttgt
gttgaaaatgttgcttatgctttaagattagcattagaaaataatcaatattcaaggaaa
atatacaatattacaaatgatgagccaatagagtttaaagagattttaactttatttttt
aatgaaatgggaacagaaggaaaatatttaaaatggaactataatttaatttcccctttg
gtttcatttttagaaattttctataaactttttagaataaaaaaagaacctccaattact
aaatatactttatatttaatgagatatagtcaaactctaaatattgataaggctaaaaaa
gaattgggctactatccgaagatgtctatactagaaggagttaaaaaatatgttgaacac
agcagaaaaaatgatagagaaagttga

DBGET integrated database retrieval system