KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN2007Help
Entry
FN2007            CDS       T00077                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fnu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FN2007
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FN2007
Enzymes [BR:fnu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FN2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(506967..507566)
Genome map
AA seq 199 aa AA seqDB search
MGNLKNHLMKYERRPIMKIYDFKVKNRKGEDISLENYKGKVLLIVNTATRCGFTPQYDEL
EALYSKYNKDGFEVLDFPCNQFGNQAPESNEEIHTFCQLNYKVKFDQFAKVEVNGENAIP
LFKYLKEEKGFAGFDSKHKLTSVLTEMLSKNDPDFAKKSDIKWNFTKFLVDKSGNVVARF
EPTTSAEVIEQEIKKLLEV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttggggaatttaaaaaatcatttaatgaaatatgaaaggagaccaattatgaaaatttat
gattttaaagtaaaaaatagaaaaggtgaagatatttctttagaaaattataaaggaaaa
gttttattaattgttaatactgcaactagatgtggatttacacctcaatatgatgagtta
gaagctttatattcaaaatataataaagatggttttgaagttttagattttccttgtaat
caatttggtaatcaagcaccagaaagtaatgaagaaatccatactttttgccaattaaat
tacaaagttaaatttgaccaatttgcaaaagttgaagttaatggagaaaatgctatacca
ctttttaaatacttaaaagaagaaaaaggttttgctggctttgattctaaacataaacta
acttctgtattgacagaaatgctttcaaaaaatgatccagattttgctaaaaaatctgat
ataaaatggaattttactaaatttttagtggataaatctggaaatgttgtagcaagattt
gaacctactacaagtgcagaagtgatagaacaagaaataaaaaaattattagaagtataa

DBGET integrated database retrieval system