KEGG   Faecalibacterium prausnitzii SL3/3: FPR_01990Help
Entry
FPR_01990         CDS       T02592                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fpa00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
181161..181766
Genome map
AA seq 201 aa AA seqDB search
MAKLYFRYGAMNSGKSTALMQVAHNYEEQGMKVLILKPQVDTKGGGELVSRLGVRRKADL
LIPPELDVFEAVQAANAASGPLACVLCDESQFFTPEQAEQLFMITVDLNIPVICYGLRAD
FSLKGFPGSTRLLELAHTIEEMKTICTCGRKAICNCRKVNGRFVFEGEQVAIDLENDVQY
VSMCPQCYFKARRAFYAARKN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattgtatttccgctacggtgccatgaacagcggcaagagcacggcgctgatg
caggtggcacacaactacgaagagcagggcatgaaggtgctcattttgaagccgcaggtg
gatactaagggcggcggagaactggtgagccgtctgggcgtgcgccgcaaggcagacctg
ctgatcccgccggagctggacgtgttcgaagctgtgcaggcggcaaacgctgcttccggg
ccgctggcctgtgtgctgtgcgacgagagccagttctttaccccggagcaggccgagcag
ctgttcatgatcacggtagatctgaacatcccggtgatctgctacggtctgcgggcagat
ttttccctcaagggcttcccgggttctacccgtctgctggagctggcgcacaccatcgag
gagatgaagaccatctgcacctgcgggcgcaaggccatctgcaactgccgcaaggtgaac
ggacggttcgtctttgagggcgagcaggtagccatcgaccttgaaaacgatgtgcagtat
gtcagcatgtgcccccagtgctacttcaaggcacggcgggcgttttacgctgcaaggaaa
aactga

DBGET integrated database retrieval system