KEGG   Faecalibacterium prausnitzii SL3/3: FPR_10020Help
Entry
FPR_10020         CDS       T02592                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FPR_10020
Enzymes [BR:fpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FPR_10020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1021291..1022868)
Genome map
AA seq 525 aa AA seqDB search
MRESGILMPVSSLPGPYGIGCFGKAAFQFVDFLSAAGQTIWQLLPLSPTGYGDSPYQSCS
AFAGNPYFVDLEALEKEGLLTAADLKAESWGKDPLEVDYGTLYVSRFAVLRKAYAAWRSQ
CAGLHGCAYYYPDDYYAFTLANEDWLEDYALYMALKVANKMKNWVEWDAPYRRRDKAALA
AFAAANEEEIGFWKFVQYKFSVQWQAVKTYANEKGVQILGDIPIYVSADSVDAWVGGKLF
ELDADGRFARVAGCPPDYFSADGQLWGNPLYDWAYHKKTGYAWWIQRVRHALGIYDLLRI
DHFRGFDTYWAIPADSTTARTGKWENGPGMELFDALEAALGKLPIIAEDLGELFPSVRKL
LADSTFPGMKVLQFAFGGGDNEYLPHNHVKNGVVYPGTHDNTTLTDWWENGASEKEKATA
AAYLHLTSCKPTAKEVAAVKTAAARTALLRAALGSVADRAIIPMYDWLGLGAEAHLNTPG
KLGGNWAWRAKTGFDTKTLAAQIKAECAVYCRCNADVQNVKELAI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagtggtattctgatgccggtatccagtctgcccggcccttacgggatcggc
tgctttggcaaggcggcatttcaatttgtggatttcctgtctgcggcagggcaaacgatc
tggcagctgctgccgctcagccccaccggctacggcgacagcccctaccagagctgctct
gcctttgcgggcaacccctattttgtggacttggaagcgctggaaaaagagggcctgctg
accgccgcagacctcaaggcggaaagctgggggaaagacccgctggaggtggactacggc
accttgtacgtcagccgctttgcggtgctgcgcaaggcctacgccgcatggcgcagccag
tgcgccgggctgcacggctgtgcctactactaccccgacgactactacgccttcaccctt
gccaacgaggactggctggaggactatgccctgtacatggcgctgaaggtagccaacaag
atgaagaactgggtggagtgggacgccccctaccgccgccgcgacaaggccgcgctggct
gcctttgctgctgcaaacgaagaggagatcggcttctggaagttcgtgcagtacaagttc
agcgtccagtggcaggcagtcaagacctacgccaacgagaagggcgtgcagatcctgggc
gatatccccatctacgtctctgcggactcggtggatgcatgggtgggcggcaagctgttt
gagctggacgccgacggccgctttgcccgggtggcgggctgcccgccggactacttttcc
gcagacggccagctgtggggcaaccccctgtacgactgggcgtaccacaaaaagaccggc
tatgcatggtggattcagcgggtgcgccacgcactgggcatctacgatctgctgcgcatc
gaccacttccgcggcttcgacacctattgggccatcccggcagacagcaccaccgcccgc
accggcaagtgggagaacggccccggcatggagctgttcgatgcactggaggccgcactg
ggcaagctgcccatcatcgccgaggacttgggcgaactgttccccagcgtgcgcaagctg
ctggccgacagcaccttcccgggcatgaaggtgctgcagtttgccttcggcggcggggac
aacgagtatctgccccataaccacgtcaagaacggtgtggtctaccccggcactcacgac
aacaccaccctgaccgactggtgggagaacggcgcttccgaaaaggaaaaagccaccgct
gcggcttatctgcacctgacctcctgcaagcccaccgccaaggaggtggcagctgtcaag
actgccgccgcgcgcactgcgctgctgcgggcagcgctgggctcggtggcggacagagcc
atcattcccatgtacgactggctggggctgggtgccgaggcgcacctgaacaccccgggc
aaactgggcggcaactgggcatggcgcgcaaagaccggttttgacaccaaaacccttgcc
gcacagatcaaagccgagtgcgccgtgtactgccgctgcaatgcagacgttcaaaacgtg
aaagaattagcaatttga

DBGET integrated database retrieval system