KEGG   Faecalibacterium prausnitzii SL3/3: FPR_11220Help
Entry
FPR_11220         CDS       T02592                                 

Definition
(GenBank) Pectin methylesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
fpa00040  Pentose and glucuronate interconversions
fpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FPR_11220
Enzymes [BR:fpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     FPR_11220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: CBL01447
UniProt: D4K9D4
Position
1148930..1149895
Genome map
AA seq 321 aa AA seqDB search
MLTINVAPDGSGQFTTISEAVLAVPYDCPAVIRIAPGIYREKLVCEKKDITLAGAGMDAT
RLVWNDGGKLPHPDGRPTHTFRSYTAFFSGEKLRVEDMTIENDAGPGAKAGQAVAAYVDS
ARAAFDRVRLLGNQDTLFCAPLPEKEREKDGFLGPRGLAPRRASAQYYHACEIAGDIDFI
FGGADALFEHCTLRTVDNGLAHSWVTAPSGAAQGLGFVFWDCDFVSDCPAGSVYLGRPWR
PTGKTAVLDCRLGAHIAPEGFAGWNDRTDTALAGFAEAGSTGAGAGERPGWVQALSAAEA
AALLRAARQKCRMETTERITE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccatcaatgttgcacccgacggcagcggacagtttaccaccatttccgaggcg
gtgctggcggtgccctacgactgccctgcggtcatccgcatcgcgccgggcatttaccgg
gaaaagctggtttgtgagaaaaaggatatcacccttgcgggcgcgggcatggatgccacc
cggctggtatggaacgatggcggcaagctgccgcacccggacgggcgtcccacccacacc
ttccgcagctataccgcctttttcagcggcgaaaagctgcgggtggaggatatgaccatc
gagaacgacgcaggccccggcgcaaaggccgggcaggcggtcgcagcctatgtggacagc
gcccgggcggcgtttgaccgcgtgcggctgctgggcaatcaggatactttgttctgcgcc
cctctgccggagaaagagcgggagaaggacggttttctgggcccgcgcgggctggcaccc
cgccgggcaagcgcgcagtattaccacgcctgcgaaattgccggagacattgattttatc
tttggcggggcagacgccctgtttgagcactgcaccctgcgcacggtggacaacggcctt
gcgcacagctgggtcaccgcaccctccggtgcggcacaggggctgggctttgtgttctgg
gactgcgattttgtctcggactgcccggcgggcagcgtgtatctgggcagaccgtggcgt
cctaccggcaagacggcggtgctggactgccgccttggggcgcacattgcgccggagggt
tttgccggctggaacgaccgcaccgacacggcgctggccggctttgctgaggcaggcagc
accggcgcaggcgcaggggagcgccccgggtgggtgcaggcgctttcagctgctgaagcc
gctgcgctgctgcgcgctgcccggcagaagtgccgcatggagactacggaaaggataacg
gaatga

DBGET integrated database retrieval system