KEGG   Faecalibacterium prausnitzii SL3/3: FPR_12230Help
Entry
FPR_12230         CDS       T02592                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:fpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FPR_12230
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    FPR_12230
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FPR_12230
Enzymes [BR:fpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FPR_12230
Exosome [BR:fpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FPR_12230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238743..1240290)
Genome map
AA seq 515 aa AA seqDB search
MKNAKISRRSFLKAGAVASAVGMLSAAPVAVHAAEADASAAADEENGLLDVFKKPKYVFL
FIGDGMGTAQIQSARFYKGTVDNNGAVTEADLSFTSFPQVGSVTTYDSTSFCPDSASTAT
SIATGHKTESGVINMCPWTRDVPYETIAEKLHAQKGYKVGVISTVNIDHATPAAFYAHQK
TRKNYYQIGVELANSGFEYFAGGEFQKVNGDGTGPDNHTVAANAGYNVVTTQAGAAALTA
GAGKTLIIAENLGDGKAMNYAMDAANGEWQLTDYVKKGIELLNNKKGFFLMTESGKIDWA
CHANDAAASIHDVLEMSNAVQAAVDFYNAHPNETLILVTADHETGGMAIGYKTTNYDTFL
TNLAHQKMSYAKFDSTYVQGYIANKTPFETAMQDVKNVFGLTLPTDPAAASAGKLLLTDY
EVENLRKAYERTLQVGSSSQSKMSQQDYELYGTYIPFSMAVCHTINHKSGMDHTTYAHTG
AMVNVYAMGVGAEKFGGVYDNTEIYHKLAELTKVQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgcgaaaatttcccgccgcagcttcctgaaagccggtgccgtggcatcggca
gtggggatgctgtcggctgcacccgtagccgttcacgccgccgaggccgatgcttctgcc
gcagcagacgaagagaacggtctgctggacgtgttcaaaaagcccaagtacgttttcctg
ttcatcggtgacggcatgggcactgcccagatccagtccgcacgcttttacaagggcact
gtggacaacaacggcgctgtgaccgaggctgacctgagctttaccagctttccgcaggtg
ggcagcgtgaccacctacgacagcacctccttctgcccggactctgcttccactgccacc
tccatcgccaccggccacaagaccgagagcggcgtcatcaatatgtgcccctggacccgc
gatgtgccctacgaaaccattgccgaaaagctgcacgcccagaagggctataaggtgggc
gtcatctccaccgtgaacatcgaccacgccacccctgctgccttctatgcccaccagaag
acacgcaagaactactaccagatcggcgtggagctggcaaactccggctttgagtacttt
gccggcggcgagttccagaaggtgaacggcgatggcaccggccccgacaaccataccgtg
gctgccaacgccggttacaacgtggtcaccacgcaggccggtgccgctgccctgaccgcc
ggtgctggcaagaccctgatcattgccgagaatctgggcgatggcaaggccatgaactac
gccatggacgctgccaacggcgagtggcagctgaccgactatgtcaaaaagggcattgaa
ctgctgaacaacaagaagggcttcttcctgatgaccgagtccggcaagatcgactgggcc
tgccacgccaacgatgccgctgcttccatccacgatgtgctggagatgagcaacgcggtg
caggctgcggtggacttctacaatgcccaccccaacgagactttgatccttgtcaccgcc
gaccacgagaccggcggcatggccatcggctacaagaccaccaactacgacaccttcctg
accaatctggcacaccagaagatgtcctacgcaaagttcgattccacctatgtgcagggc
tacattgccaacaagaccccctttgagactgccatgcaggacgtgaagaacgtctttggc
ctgaccctgcccaccgaccccgctgccgccagcgcaggcaagctgctgctgaccgactac
gaggtggagaacctgcgcaaggcctacgagcgcaccctgcaggtgggttcctccagccag
agcaagatgagccagcaggattacgagctgtacggtacctacatccccttcagcatggct
gtctgccacaccatcaaccacaagtccggtatggatcacaccacctacgcccacaccggt
gccatggtcaacgtgtacgccatgggtgtcggtgccgagaagttcggcggtgtatacgac
aacaccgagatctaccacaagctggctgagctgaccaaggtacagtaa

DBGET integrated database retrieval system