KEGG   Faecalibacterium prausnitzii SL3/3: FPR_17200Help
Entry
FPR_17200         CDS       T02592                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fpa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fpa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fpa00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1750424..1752589)
Genome map
AA seq 721 aa AA seqDB search
MIVCTETVFTLHTTHTSYQLAVAPNGMVLHTYYGTRLPEDVPSLADARMPHSDPGCWPDL
LPQELSGCGTADNRTPAVIPEYADGTEAAAFVFDHAVVTPGKPQLPGLPMFRTGEGVETL
SVFLKDAGGLVVELRYSVYEAEDLITRTAVYTNAGTQSLTLHKAASLSVDFAPDALELIT
LNGTWAAERTLERAALRCGIQSIGSMRGVPGHAHNPAVALCHADTNETTGDAWGFAFVYS
GNYLIEAERCDAGERLVMGIHPYHFHWTLAPGESFTAPEAAMVYSDKGLGEMSRRFHTAI
RTRLLPPHWQDMAAPRPVLINSWEACYFDFDEEKLLALAQASKKADIDLFVLDDGWFKGR
NDTSSSLGDWAADTRKLPQGLPGLCKKINLLGLDMGLWVEPEAISPDSDLYRAHPDWAFG
IPGREPLEIRQQYTLDFSRPEVVAGIWQQLDAVLQSCPLKYLKWDMNRSLAQVYSAVLPA
KRQGEVYHRYVLGVYELQRRLTEKYPHLLLENCAGGGARFDCGMLYYSPQIWCSDNTDAR
SRLVIQYGTSLFYPGCVMGAHFSTVPNHCTGHISTVEARMAAALTGTFGFELDLTKYTEE
ELAQLRSFVAWYRAHGALLRGGELHRLVNPDANGLGAAWMLSAKDGSEAAVFAVGDALTG
SHGTASLNARPRLVLAGLDPAAQYRDEENNTYTGAQLLTTGLELPGGYGQMPAKIWYLKK
V
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtctgcaccgaaactgtctttaccctgcataccacccacaccagctaccagctg
gcagttgcccccaatggcatggtgctgcacacttattacggcacccgtctgccggaggat
gtgcccagccttgcggatgcccggatgccccacagcgaccccggctgctggccggacctg
ctgccgcaggagctttccggctgcggcaccgctgataaccgcactcccgccgtcatcccg
gaatacgctgacggcaccgaagcagccgcctttgtgtttgaccacgctgtggtcaccccc
ggcaagccgcagctgcccggcctgcccatgttccgcaccggggagggtgtagaaacatta
tcggtctttctgaaggacgcaggcgggctggtagtggagctgcggtacagcgtgtacgag
gcggaggatctcattacccgcaccgccgtgtacaccaatgcgggcacccagtccctgaca
ttgcacaaggccgcttccctttccgtagactttgcgccggatgcgctggaacttatcacc
ctcaacggcacatgggcggcggagcgcaccctagaacgtgcggcgctgcgctgcggcatc
cagagcattggcagtatgcggggcgtccccggccacgcccacaacccggcagtcgccctc
tgccatgccgataccaacgaaacgaccggcgatgcatggggatttgcctttgtgtacagc
ggcaactacctcattgaggccgagcgttgcgacgccggtgagcgtctggtgatgggcatc
cacccctaccacttccactggacgctcgcccccggtgagagcttcaccgccccggaagct
gccatggtctactccgataaaggtctgggtgagatgagccgtcggttccacaccgccatc
cgcacccggctgctgccgccccactggcaggatatggccgcaccccgcccggtgctcatc
aacagctgggaggcctgctacttcgattttgacgaggagaagctgctggcactggcgcag
gcttccaaaaaggcagacatcgacctgtttgtgctggacgatggctggttcaagggacgc
aacgatacttcttccagtttgggcgactgggcagcggacacccgcaaactgccacagggt
ctgcccggcctgtgcaaaaagatcaatctgctggggctggacatggggctttgggtggaa
ccggaggccatcagcccggacagtgacctctaccgtgcccacccagactgggcgttcggc
attcccggccgggagcctttggagatccggcagcagtacacgctggatttcagccgcccg
gaggtggtagcgggcatctggcagcagctggatgccgtcttgcaaagctgcccgctgaaa
tacctcaagtgggacatgaaccgcagtctggcacaggtgtacagtgccgttctgcctgcc
aagcggcagggcgaggtgtaccaccggtatgtgctgggggtgtacgaattgcagcgccgt
ctgaccgagaaatacccccacttgctgctggaaaactgtgcaggcggcggagcacggttc
gactgcggaatgctctattacagcccccagatctggtgcagcgataacaccgatgcccgg
agccgcctagtcatccagtatggcaccagcctgttctaccccggctgtgtgatgggtgca
cacttttccaccgtgcccaaccactgcaccggccacatctccacggtggaagcacggatg
gcggcagcacttactggcaccttcggctttgagctggatctgaccaagtacacggaggaa
gagcttgcgcagctgcgttcctttgtggcatggtatcgtgcccacggtgccctgctgcgg
ggcggggagctgcaccggctggtaaacccggacgcaaatggtctgggtgctgcgtggatg
ctttccgccaaggacggcagcgaggcggcggtgttcgccgtgggagatgctttgaccggc
agccacggcaccgccagtctgaatgcccgtccccggctggtgctggcagggctggacccg
gcggcacagtaccgggacgaagagaataacacctacacaggggcgcagctgctgaccacc
ggcttggaactgcccggcggctacggccagatgcccgcaaagatatggtatttgaagaaa
gtgtga

DBGET integrated database retrieval system