KEGG   Faecalibacterium prausnitzii SL3/3: FPR_17560Help
Entry
FPR_17560         CDS       T02592                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fpa01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:fpa00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1792097..1793374)
Genome map
AA seq 425 aa AA seqDB search
MIKLYNFDELKPEEILNRDIRAEKNVEDVVDAIIADVRARGDDALKDYALKFDGATIENL
QVTQAEIDEAFAGMDPYFLETLRQAAENIEQFHRQQVHKNFVMNDRPGIVLGQKYTPIEK
AGVYVPGGTAAYPSTVLMDVIPAKVAGVSEIVMTTPAGKDGKVNPVILAAAATAGVTKIF
KTGGAQAVAALAYGTQSIPAVDKIVGPGNIYVATAKRKVFGKVGIDMIAGPSEILVLADG
SCDPAWVAADLLSQAEHDRLASPVLVTDSAALAKAVQAELEVQIPQLPRAAIARASVDDN
GKIILCTDLHKAIEACNIIAPEHLEVCVEDPFGVLNEIRNAGSIFLGRNVPEALGDYFAG
PNHTLPTSGTARFSSPLGVDDFVKKSSFIYYTRDALEAVAPRIADFAEREGLHAHARSVT
IRYEK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgtataattttgacgagctgaaaccggaggaaattctgaaccgggacatc
cgcgccgaaaagaacgtggaggacgtggtggacgccatcattgcggacgtgcgcgcccgg
ggcgacgacgccctgaaggactacgccctgaaatttgacggcgcaacaatcgaaaattta
caggtgacgcaggccgagatcgacgaagcctttgcgggcatggacccctattttctcgag
accctgcggcaggcggcggagaacatcgagcagttccaccgccagcaggtacacaagaat
tttgtgatgaatgaccgccccggcatcgtactggggcagaaatacacccccattgaaaag
gccggtgtgtatgtgcccggcggcacggcggcgtacccttccaccgtgctcatggacgtc
atccccgccaaggtggccggggtgtccgagatcgtcatgaccacccccgccggaaaggat
ggcaaggtgaacccggtcattctggccgctgccgccaccgccggggtgaccaaaattttc
aagaccggcggcgcacaggccgtggcggcgctggcctacggcacccagagcatcccggcg
gtggataagatcgttggccccggcaacatctacgttgccaccgccaagcgcaaggtgttt
ggcaaggtgggcattgatatgatcgcgggtcccagcgaaattctggtgctggcagacggc
agctgtgaccccgcatgggtagcggcagacctgttaagtcaggccgagcacgacaggctg
gcaagcccggtgcttgtcaccgacagcgcagcccttgccaaagcggtacaggcagaactg
gaggtacaaattccgcagctgccccgcgccgccattgcccgcgccagcgtggacgacaac
ggcaagatcatcctctgcaccgacctgcacaaggccattgaggcctgcaacattatcgca
ccggagcacttggaggtctgcgtggaggaccccttcggggtgctgaacgagatccgcaac
gcgggcagcatcttccttggccgcaatgtgccggaggcgctgggcgattactttgcaggc
cccaaccacaccctgcccaccagcggcaccgcacgcttttccagcccgctgggcgtggac
gacttcgtcaagaagtccagcttcatctactacacccgggacgcgctggaagccgttgcg
ccccgcattgcagactttgccgagcgcgagggtctgcacgcccacgcccgcagcgtgacc
atccggtatgagaagtaa

DBGET integrated database retrieval system