KEGG   Faecalibacterium prausnitzii SL3/3: FPR_23960Help
Entry
FPR_23960         CDS       T02592                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fpa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FPR_23960
  Lipid metabolism
   00561 Glycerolipid metabolism
    FPR_23960
   00600 Sphingolipid metabolism
    FPR_23960
Enzymes [BR:fpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     FPR_23960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2413469..2414299
Genome map
AA seq 276 aa AA seqDB search
MVQEIHASGFQAGLWLAPFVCEKDSALFRQHPDWLLKVDGKPWCCGSNWSSFYALDIDNP
AVLDYLRRVFDRVLNDWGFDLVKLDFLYGAAPFGNARESRAARMRRAMELLRSWCGQKAI
LGCGVPVMPAFGLVDYCRVSCDVGLDWDDVWYMRLFHRERVSTKQALNNTVFRRQLNGRA
YGSDPDVFFLREENCKLTAEQKRTLATVNALLGNVFLASDMPSHYTDAQRDEYRRLRRLF
EHAKQVEVETENGVITIRYSLDEKRQELRCSAIYRE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaatccacgcctctggctttcaggccgggctctggcttgcaccctttgtg
tgcgaaaaggactctgcccttttccggcagcacccggactggctgctgaaagtggacggc
aaaccgtggtgctgcggcagcaactggagcagcttttatgcactggatatcgacaacccg
gccgtgttggactatctgcgccgggtatttgaccgggtgctgaacgattggggtttcgac
cttgtcaagctggattttctgtacggcgctgctccctttggcaatgctcgcgagagtcgt
gccgcccggatgcgccgtgccatggagctgctgcgtagttggtgcggacaaaaagccatc
ctcggctgcggcgtgccggtgatgcctgccttcgggctggtggactactgccgtgtcagc
tgtgacgtagggctggactgggacgatgtgtggtatatgcgcctgttccaccgggagcgg
gtgtccacaaagcaggcgctgaacaacacagtgttccggcggcagctcaatggccgtgcc
tatggcagcgacccggatgtgttcttcctccgggaggaaaactgcaagctgacggcagag
caaaaacgcacccttgccacagtcaacgcactgctgggcaatgtgttccttgcctcggat
atgccgtctcactacacggatgcgcagcgggacgagtaccgccgcctgcgcaggttgttt
gaacatgcaaaacaggtagaagtagagacagaaaatggtgtgattacgatccggtattct
ctggatgagaaacgtcaagagctgcggtgcagtgctatttatagagaataa

DBGET integrated database retrieval system